KEGG   Trypanosoma cruzi: 506567.70Help
Entry
506567.70         CDS       T01012                                 

Definition
NAD(P)-dependent oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tcr  Trypanosoma cruzi
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    506567.70
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    506567.70
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     506567.70
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 266 aa AA seqDB search
MSGQKRVLSGRVAVVTGSRKGIGLGIAMRLAMAGADVVLNGRRQSPEDSAIVEKVAAYGT
RVRCFAADLKDRAQVEALIKFTEKELGAVEILVNNAGIQHVSPVETFPSDKWDEIIALNL
TSAFHATQLCLPGMRQRGWGRIINIASVQGLVGSVNKSAYCAAKHGLIGFTKVVALETAT
TGITCNAICPGYVYTPLVEEQIKAVAEAKYGGDMEAATQAFLCEKQPAKAFVTVEQVGDA
AVFLASPGADLIRGTTITVDGGWVAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacaaaaaagggttttgtcagggagggtggcagttgtcacggggtcaagaaag
ggtatcggtctcggcattgcgatgcggctggcgatggctggagcggatgttgttcttaat
ggcaggcgccagagtccagaggattcggcgattgtcgaaaaagtggccgcctacggcacg
cgcgttcgctgctttgctgccgacttgaaagatcgtgcacaggtcgaagcgctgataaag
tttacggagaaggagctgggcgccgtggaaattctggtcaataacgccggtattcagcac
gtctccccagtggaaacatttccttccgacaagtgggacgaaatcatcgctctgaatctc
acatccgcttttcatgcgacgcagctgtgtctgccgggcatgcgtcagcgcgggtggggc
cgcattattaacattgcctcggttcaagggttggtgggttcggtgaataaatctgcttac
tgtgctgccaagcacggtctcattggattcaccaaagttgtggccctggaaactgccacg
acaggaattacttgcaacgcgatatgtcccgggtacgtctatacacccttggtggaggaa
caaatcaaagcggttgctgaagcaaaatacggcggtgacatggaggccgcaactcaggca
tttctctgtgaaaaacaaccagcaaaagcatttgtgactgtcgagcaggttggagacgct
gcggtgtttctcgcaagtccaggggcagacctgattcgcggcaccacaatcaccgtggat
ggtggatgggtcgcccaatga

DBGET integrated database retrieval system