KEGG   Trypanosoma cruzi: 506585.70Help
Entry
506585.70         CDS       T01012                                 

Definition
P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     506585.70
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 629 aa AA seqDB search
MLFYLIGTIVIAAVFAWLTGILGLNSHSHAKTPMKTAITEKKVSTERKEVCVLFGSQTGT
AEMFAKTLVREGTRLGVPIRICDTENYEGHDLEYEHLVIIICSTYGEGEPTDSMKAFHDW
LMDDSRTPDEELRNVKYAVFGLGDRQYRYFCEEGIVVDRRMAELGAQRIYGLGCGNAGEN
IEEDFDEWHRDLWPAVSRVLGIELRQHAEEPMEPACRMKVWEPSEEASLPFPKLASVLEP
TQRLPAWAPLTANKELLRNTTERSTRFIELSIEDTIISYQSGDHLGILPHNTDAMVNAYL
QILGVSEEEAMQVFSLQEKKTGKNVFAARVTVRTALKWYIDLAGPPRKSTLRAFAHYAKD
PAEKEELLKLLRVEPESAKEYAKLSAKLRTVHGFLRKYHTISVPLEFFLEMMPRIAPRYF
SISSDLLSHPGRLSITAAILEGGLCTGMLRELQIGEKIPVFVRKSKFHLPLREKERPIVM
IGPGTGVAPLIGFLHRRNAWKKRGNKLGKAILFFGCRRKEEDHIYSDFMTECLENGTLSA
LDVCYSREQATKVYVQHRVLARADEVWDILREGGNIYLCGDAKYMAKDVERALLEILQEK
ALMSEEDAQAYLAKLNNIGRYLKDVWSAS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgcttttctacctaattgggacaattgttattgcggctgtttttgcctggttgacaggc
attcttggcttgaactctcactcacatgccaagacgccgatgaagactgcgataacggag
aagaaggtgtcaacagagcgaaaagaagtctgcgttttattcgggagtcaaacggggacg
gcggaaatgtttgcaaagacgcttgtgcgggaggggacacgactgggggttcctataaga
atttgtgatacggagaactacgaggggcacgaccttgaatacgagcatcttgtgatcatt
atctgctccacctacggcgagggagaacccacggactcgatgaaggcattccacgactgg
ttgatggatgacagccgcacccccgatgaggagctgcgaaatgtcaagtacgccgtattc
ggcttgggcgatcgccaataccgttacttctgtgaggagggcattgtggtggatcgtcgc
atggcggagttgggggcgcagcgtatatatggcctgggctgtggcaacgcgggggaaaat
attgaggaagactttgatgagtggcatcgtgacttgtggccggcggtgagtcgcgtgctc
ggcattgagttgcgtcaacacgcggaggagccgatggagccggcgtgccgcatgaaagtg
tgggagccatccgaggaggcgtccctcccgttcccaaaacttgcttccgtattggagcca
acccaacgccttccggcgtgggcgccgttgaccgcgaataaagagcttctgcgtaacacc
accgagcgcagcacacgatttattgagttgagcattgaggacaccatcatctcgtatcaa
agtggcgaccatcttggcattcttccacacaacaccgatgcgatggtgaatgcctacctg
cagatactaggtgtcagtgaggaggaggcgatgcaggtgttctccttgcaggagaagaaa
actggcaaaaatgtatttgcagcccgtgtcacggttcgaactgcactcaagtggtacatt
gacctcgccggaccgccaaggaagtccacattgcgtgccttcgcccactacgcgaaggat
ccggcagaaaaggaggaattgttgaaattgttgcgcgtggagccggagtctgcgaaggag
tacgccaaactttcagccaagttacggaccgttcatgggttcctgcgaaagtaccatacg
atttcggtcccacttgagtttttccttgagatgatgccacgtattgctcctcgctacttt
tcgatttcctccgatctcctctcccatcccggcagactttccatcacggcggcgatttta
gagggagggctttgtacaggaatgctgcgggaactgcaaattggagagaaaattcccgtg
tttgtgcgcaaatcaaaattccacctcccgttacgagagaaggaacggccaattgtgatg
attgggcccggaacaggcgtggcgccccttataggttttctccatcgccgcaacgcatgg
aagaagaggggcaataaacttggcaaagcaattctcttctttggatgtaggcggaaagag
gaggatcacatttacagcgattttatgacggagtgtttggaaaacggaacgctgtcagcg
ttggatgtctgctacagtcgggagcaggcgacaaaggtctacgtgcagcaccgtgtgttg
gctcgtgcagatgaagtttgggacattttacgcgaaggagggaatatttacctctgcggt
gatgcaaagtacatggcaaaagacgtagaaagagcgctgttggaaatcttgcaggagaag
gcgctcatgagtgaagaagatgctcaggcatacctcgcgaagcttaataatattgggcga
tatttaaaagatgtttggtctgcatcctag

DBGET integrated database retrieval system