KEGG   Trypanosoma cruzi: 506773.140Help
Entry
506773.140        CDS       T01012                                 

Definition
DNA ligase (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tcr03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tcr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tcr03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:tcr03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 583 aa AA seqDB search
MMKLHRILRSLPFVPMALSTFDTIERSAASSTATDSTSHSFVSDGPPYFISPKHDGVRIL
SYVSEHAESLKSTCFSRFGRPVHGMFWIEEELRLLRWLCGDPRLVLDGELYVHKEPHARS
TGDDGARTGFFSVSALVHRLRGPKSACSSEEEVLSYVASLPRLCVFDIVSFQPSDKTNLS
EESSGRGLSRIEKERVSLLREVMKANGVRDLEMLRVIPNYSVFSQRLKAMHFLMCVLHRA
RASSILFPGRAVSVTTSKKHEMKRRNGNSSDMAVGVTNVGGEYLQLVKYSLLHSLDDAKK
VYLKKYLSCGYEGAVIRSASNVYELKEKERGVLLGLLDPLISVGERPFVNKQAACWPKRS
LLVAEAPPLLRTYAKNGLLASMGSGEYDWTDFVADENEAEEANHQAVVGAAVRRAKQNAR
RSTTAVKLLPFCDREYAILKPLLKIPSANPRARKLVSVPLKLLHGGRDAISVPRTAFGKA
ASKKNEKSKVAVFYGLQCLSETGRVFNVSLPKMDVAKQRALLDHLLEVTGGSRKMGGKRN
TGGVGCRSLTGLYATVKYSSLTEYGIPRFGQVKAIRGGKGWFL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcttcatcgcattctgcgtagtctaccttttgtaccaatggctttatccacc
tttgataccatagaacgctctgcagcttcttctactgccacagattcaacatcgcattca
tttgtgtcagatggtccaccatacttcatctcaccgaagcatgacggagtgcgcatcctg
tcgtacgtgagtgaacatgccgaatccctcaaatcaacgtgtttttctcgctttgggcga
cctgttcatggcatgttttggattgaagaagaactccgtctcttgcgatggctctgcgga
gacccacggctggtcttggatggagagctatacgttcataaagagcctcatgcacgatca
acgggtgacgatggggctagaaccgggtttttctctgtttcagctctggtgcatcgtttg
cgcgggcctaaatcggcctgttcctctgaggaggaggtgctcagttatgttgcgtcactc
ccccgtttgtgtgtgtttgacattgtttcctttcagccatcggacaagacaaatttgtct
gaggagagcagtgggcgaggcctttcgcggattgagaaggagcgcgtgtcgcttctccga
gaggtgatgaaggccaatggcgttcgtgatttagaaatgctgcgtgtcattccaaattat
tcagtcttttcacagcgattgaaggcgatgcattttctaatgtgcgtcttgcatcgcgcc
cgcgcctcttctattttgttccctggcagggctgtgagtgtcaccacctccaagaaacat
gagatgaaaagacgaaacggcaactcttccgatatggcggtgggtgtgacaaacgtcggt
ggggagtatttgcagcttgtgaagtactcgctgcttcactcccttgacgatgcaaaaaag
gtgtatctcaagaaatatctctcatgcgggtatgaaggtgccgtcattcgcagtgcgtca
aatgtgtatgagctgaaggagaaggaaagaggtgtcttactggggctcttggacccactc
atttccgtgggggaacgcccgtttgtgaacaaacaggctgcctgctggccaaagcggtcg
cttctggtggcggaggccccgccactccttcgcacatatgccaagaacggattgctcgct
tccatgggttctggtgaatacgattggacggattttgtagcggatgagaatgaagcagag
gaggcgaatcaccaggctgtcgtgggggcagcagtaaggcgggcaaagcagaatgctcgc
cgtagcaccacagctgtcaaattgcttccgttttgtgacagggagtatgcaattctaaag
ccactgctgaagataccgtcagccaacccacgcgctcgaaaacttgttagcgttcctctg
aaattgcttcacggaggtcgtgatgccatctcagtccctcggaccgcttttgggaaggcc
gcgtccaagaagaatgagaagagcaaagtggcagttttttacggtctgcagtgtctcagc
gaaacggggcgtgtgtttaacgtttcacttcccaagatggatgtcgcgaagcagcgagcc
ttgctggatcacctcttggaagtgacagggggctccaggaagatgggtgggaaaagaaac
actgggggagttggttgccgttcactgactggtttgtacgccacggttaagtattcttca
ctcacggagtacggcattccgcgttttggtcaagtgaaggccatacgcggaggcaaggga
tggtttttgtga

DBGET integrated database retrieval system