KEGG   Trypanosoma cruzi: 506779.150Help
Entry
506779.150        CDS       T01012                                 

Definition
histone H2B variant
Orthology
K11252  
histone H2B
Organism
tcr  Trypanosoma cruzi
Brite
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   506779.150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 143 aa AA seqDB search
MPPTKGGKRPLPMGGKGKGKRPASATRKASGGKKKGGARRGKKQQRWDLYIHRTLRQVYK
RGTLSKAAVRVLSSFIEDMYSKIQSEAVHVACINNVKTLTAREIQTSARLLLPPELAKHA
MSEGTKAVAKYNASREEAYAKVV
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaacaaaaggagggaagcggcctcttcccatgggcgggaaaggcaaaggaaag
cgacctgcaagcgccacgcggaaggcttcgggcggtaagaaaaaggggggcgctcgccga
gggaagaagcagcagcggtgggatctgtacatccacaggaccctgcgtcaagtttacaag
cgtgggacgctttccaaggcggccgtgcgtgtgctttcgtcctttattgaggacatgtac
agcaagattcagagcgaagcagttcatgtggcgtgcataaacaacgtgaagacactgacg
gcacgtgaaattcaaacatctgctcgtctgcttctgccgccagaactcgccaagcatgca
atgagcgagggcacaaaggctgttgccaaatataacgcttcacgcgaagaggcctacgcg
aaggtggtgtag

DBGET integrated database retrieval system