KEGG   Trypanosoma cruzi: 506821.140Help
Entry
506821.140        CDS       T01012                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 511 aa AA seqDB search
MAFTDAVAGKTSLPPPVAIIVGHNIDASAMPLTYERNRLVIDMLQHYACPVFSHKKSGDA
MNTVSSDVFEWVLEPLPVVGVEDMTAFHDRAYLNYLSIREALSEVDERASTVKRSRAEGI
QPPVSRRSSAQNQPPLRVLPDLVPIPTDEEYGLVNENMPFVGMWRTIQATVSGTLLAARL
LAQPGRFAAIHWFGGRHHAKQSTAGGFCFANDVVLGVLELKKLLSSDKKGILVVDVDAHH
GDGTQSAFLHDNSVLTLSMHAHGVGIFPGSGGIEEIGAGLGRGFTMNVPLPEGATDILAV
TLMYRSIHFAFKKLGEGLAAIVIVCGSDALSGDPLGALNLTVGGMQSIIRLLLKEAARRS
LKVLLLGGGGYVDTSCARLAGVVTKDVLSCAAAMRLGKTEYFGDSANLGDNLGVAVPEGC
EYFTRYGPSFLMHGLPPARVSKLYRLPYGSPLFMRMQRAATKEALRRRRNQEQDEEEEEE
EEEEEEEEEEEEEEEEEEEVEEEEGEGEEEA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaccgacgcagtggctggaaagacgtcactgccaccccctgtggcgattatc
gtgggccacaatattgatgcctccgccatgccacttacgtatgagcgaaatcgccttgtc
atagatatgctgcagcattatgcgtgccctgttttttctcataaaaagagcggtgatgcc
atgaatacggtttcaagcgatgtttttgaatgggtcttggagccccttcccgtagttggt
gttgaggatatgacggcatttcatgacagggcatatttaaattatttaagtatccgtgag
gccttgtctgaggtggatgagcgggcatcaactgttaagcgttcaagggctgaaggaatt
caaccccccgtttcaagaagatcatctgcgcagaaccaaccccctctgcgtgtgctaccc
gaccttgtgcctataccaaccgatgaagagtatggccttgttaatgagaacatgcctttt
gtaggcatgtggagaaccattcaagctacagtatcaggtacccttttggctgctcgttta
ctggctcaacctggccgttttgctgcgattcattggtttggtggaagacatcatgctaag
caaagtactgcggggggtttttgttttgcaaatgatgtggttcttggggttcttgaactg
aagaagttactttcttcagataagaagggtattcttgtagtggatgtggacgcacatcac
ggtgacggcacgcaatcagcatttctgcatgataattctgtgttgacgttatccatgcac
gcgcatggggttgggatctttcccggatccggtggaattgaggagattggtgctgggctg
ggacgtggcttcacgatgaatgtcccattaccagaaggcgcaaccgatattcttgccgtt
acattgatgtatcgatcgattcattttgcatttaaaaaactgggggaaggtctggctgct
attgttattgtctgtggttcagacgcccttagtggagatccgttaggcgctctcaatctt
acagttggcgggatgcaaagcatcatcagattacttctgaaggaagcagctcgccgctca
ctcaaggttcttctcctaggtgggggcggctatgtggatactagttgtgctcgtcttgca
ggggttgtcacgaaggatgtgcttagctgtgcagcggcaatgcgcctgggtaaaacggaa
tactttggagactcggccaatctgggggataatctgggtgtggccgtccctgagggttgt
gagtacttcactcgatacggaccgtcattcctcatgcatggccttccacctgctcgcgta
agtaaactatatcggcttccttatggctccccactgtttatgcgtatgcagcgggcggca
acaaaggaggctttgcggcgccggcgaaatcaagaacaggatgaggaagaggaagaagaa
gaggaagaagaagaggaagaagaagaggaagaagaagaggaagaagaagaagaggaagtg
gaagaggaagagggagagggggaggaagaagcatag

DBGET integrated database retrieval system