KEGG   Trypanosoma cruzi: 506869.50Help
Entry
506869.50         CDS       T01012                                 

Definition
calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tcr  Trypanosoma cruzi
Brite
Protein phosphatases and associated proteins [BR:tcr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     506869.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 176 aa AA seqDB search
MGEGSSFTPEEMRQLREATALSEAQIVRLHKRFATLAQGGRGVLTAEALSSISSVASNPL
LGRVLAVLDTSGDGKIDFMTFAKALAVFSPQADKRERLRFTFKMYDVDGDGKISNKDLFE
TLTIMVGTNLTGVQLQQIVDKTFIEVDLNRDGYITFEEFEKLSLLNNFGDRLSLSI
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggggtcttccttcacgcccgaggagatgcggcagttgcgagaagcgactgca
ctttccgaggcacaaattgttcgacttcacaagcggtttgcgacgctcgctcagggggga
cggggagtcctgacagcggaggcgctcagctccatctcctcagtggcctcaaaccctctg
ctcgggcgtgtactggcggtgttggatacaagtggggacggaaaaattgactttatgacg
tttgcaaaggcccttgccgttttttccccgcaggctgacaagcgggaaaggctgcgtttt
accttcaagatgtacgatgttgatggcgacggcaagatcagcaacaaggacctgtttgag
acgctgacgatcatggtgggaaccaatctcacgggggttcagctgcagcagattgtggac
aaaacatttattgaagtggacttgaaccgtgacgggtacattacatttgaagaatttgag
aagttgtccctcctgaacaattttggagatcgccttagcctctccatttag

DBGET integrated database retrieval system