KEGG   Trypanosoma cruzi: 506925.480Help
Entry
506925.480        CDS       T01012                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tcr  Trypanosoma cruzi
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    506925.480
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     506925.480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 330 aa AA seqDB search
MNRLHVIESHEGSNGPTVVVVGSCFLDYIAYVDRIPRIGETLTSKSFSKGFGGKGANQAV
AAGRLGARVAMVGIVGSDGDGDEYIANFKRNGVDTTNVYRERNGATGLAMIFVDTKTSNN
EIVICPNATHALTTEFLRRQSDNYNRFLSQSCRFLICQNEIPLETTLDVLREAHKRGIYT
VFNSAPAPSLAEVGVIKPFLPYVSLFCPNEVEAAMITGMEVSDGASAAKAAKALQALGVR
NVVITLGAQGYVICEMGSEPMHAPGLRVKAVDTTGAGDSFVGSMVYYMSRGMSLSEACRR
ANVCAAFSVQRKGTQSSYPTPDELPADARA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccttcatgtaatcgaatcccacgaaggaagcaacggtcccacggttgtagtt
gtgggctcctgcttcctggactacatcgcctatgtggaccgcattccgaggattggggag
acactcacatccaagagcttctctaaaggattcggtgggaaaggcgccaaccaggctgtg
gctgccggccgacttggcgcgcgcgtggccatggtgggtattgtcggctccgacggcgac
ggtgacgaatacattgcgaattttaaaaggaatggggtagacacaacgaacgtgtaccgg
gagcgcaatggcgcgacagggctggccatgatttttgtggacaccaagacgtcaaacaac
gaaattgtgatttgtcccaacgcgacacatgcactgaccaccgaattcttgcgtcgtcag
tcggacaattataatcgttttctttcgcagagttgccgttttctcatctgccagaacgaa
attcctcttgaaacgactcttgatgtgctacgagaggcacacaagcgcggtatttacact
gttttcaactccgccccagctccctcgttggcggaagtgggggttattaagccgttcctg
ccgtacgtttcgcttttctgcccgaatgaagtagaagctgcaatgatcaccgggatggag
gtgagcgatggggcgtccgctgccaaagccgcgaaagccctgcaggcacttggcgtgcgg
aatgttgtcatcacgcttggcgcgcagggttacgtcatttgcgagatgggatcagagccg
atgcatgcgccaggccttcgtgtgaaggctgtggacaccacgggcgctggcgattccttt
gttgggtcgatggtgtactacatgtcgaggggcatgtcgctttcagaggcctgtaggcgg
gcaaatgtttgcgctgcgttcagcgtgcagcgcaagggcacccagagttcttaccccaca
cccgacgaactccctgcggacgctcgggcgtaa

DBGET integrated database retrieval system