KEGG   Trypanosoma cruzi: 507049.60Help
Entry
507049.60         CDS       T01012                                 

Definition
NAD(P)-dependent oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tcr  Trypanosoma cruzi
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tcr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:tcr00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 266 aa AA seqDB search
MSGQKRVLSGRVAVVTGSRKGIGLGIAMRLAMAGADVVINGRRQSPEDSAIVEKVAAYGT
RVRCFAANMKDRAQVEALIKFTEKELGAVEILVNNAGIQHVSPVETFPSDKWDEIIALNL
TSAFHATQLCLPGMRQRGWGRIINIASVQGLVGSMNKSAYCAAKHGLIGFTKVVALETAT
TGITCNAICPGYVYTPLVEEQIKAVAEAKYGGDMEAATQAFLCEKQPAKAFVTVEQVGDA
AVFLASPGADMIRGTTITVDGGWVAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacaaaaaagagttttgtcagggagggtggcagttgtcacagggtcaagaaag
ggtatcggtctcggcattgcgatgcggctggcgatggctggagcggatgttgttattaat
ggcaggcgccagagtccagaggattcagcgattgtcgaaaaagtggccgcctacggcacg
cgcgttcgctgctttgctgccaacatgaaagatcgtgcacaggtcgaagcgctgataaag
tttacggagaaggagctgggcgccgtggaaattctggtcaataacgccggtattcagcac
gtctccccagtggaaacatttccttccgacaagtgggacgaaatcatcgctctgaatctc
acatccgcttttcatgcgacgcagctgtgtctgccgggcatgcgtcagcgcgggtggggc
cgcattattaacattgcctcggttcaagggttggtgggttcgatgaataaatctgcttac
tgtgctgccaagcacggtctcattgggttcaccaaagttgtggccctggaaactgccacg
acaggaattacttgcaacgcgatatgtcccgggtacgtctatacacctttggtggaggaa
caaatcaaagcggttgctgaagcaaaatacggcggtgacatggaggccgcaactcaggca
tttctttgtgaaaaacaaccagcaaaagcatttgtgactgttgagcaggttggagacgct
gcggtgtttctcgcaagtccaggggcagacatgattcgcggcaccacaatcaccgtggat
ggtggatgggtcgcccaatga

DBGET integrated database retrieval system