KEGG   Trypanosoma cruzi: 507091.50Help
Entry
507091.50         CDS       T01012                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tcr  Trypanosoma cruzi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tcr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tcr00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 327 aa AA seqDB search
MLELPPVASLKGKSITSAEQFSRADIYALIHLASAIQRKIDAGEVLNLLQGRIMTPLFFE
DSSRTFSSFCAAMIRIGGSVVNFKVEASSINKGETLADTIRTLDSYSDVLVMRHPRQDAI
EEALSVAQHPILNAGNGAGEHPTQALLDTLTIYSELGSVDGITIALIGDLKMGRTVHSLL
KLLVRNFSIKCVFLVAPDALQMPQDVLEPLQHEIATKGVIIHRTHALTDEVMQTSDVLYT
TRLQKERFMASTSDDAAALQSFAAAKADITIDAARMKLAKKKMIVMHPLPRNDELSTTVD
ADPRAAYFRQMRYGMFMRMAILWSVLA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttggaactgccgccagtagcgagcctgaagggcaaaagcatcacaagtgccgaacag
ttcagtcgtgcggatatctacgcgctgattcatcttgcaagtgccattcagcgtaagatt
gatgcgggtgaggtgctgaatctcctgcagggccgcatcatgacgccacttttttttgag
gattcctctcgcaccttcagttccttttgtgccgcgatgattcgaattggtgggagcgtg
gtgaactttaaggtcgaggcgtcatccatcaacaagggcgagaccctcgccgacaccatt
cgcacactggactcctacagcgacgtgctggtgatgcggcatccaaggcaggatgcgatt
gaggaggccctttccgtggcgcagcatcccattctgaatgcgggcaatggggctggcgaa
cacccaacgcaggcgcttctggacacgctgacgatttattcggaattgggcagcgtagac
ggcatcaccatcgcgctgatcggagaccttaagatggggcgaacggtgcactctcttctg
aagcttcttgtacgcaacttttcgattaaatgtgtgtttcttgtcgccccggacgcactg
cagatgccgcaggatgtgctggaacccctgcaacacgagatcgccacgaagggagtgata
attcaccgcacacacgcactgacagatgaggtcatgcaaacgagtgatgtgttgtacaca
acgcgtctgcagaaggaacggtttatggcttccacgagcgatgatgcggcggcgttgcag
tcatttgcggcggcgaaagccgacatcaccatcgacgcggcacgtatgaagctggcgaag
aaaaaaatgattgttatgcacccactgccacgcaatgacgagttaagcactaccgttgat
gcagacccacgtgctgcctactttaggcaaatgcggtacggcatgtttatgcgcatggcc
attttgtggagcgttttggcgtga

DBGET integrated database retrieval system