KEGG   Trypanosoma cruzi: 507507.40Help
Entry
507507.40         CDS       T01012                                 

Definition
ubiquitin hydrolase (EC:3.1.2.15)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     507507.40
Peptidases [BR:tcr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   507507.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 438 aa AA seqDB search
MSGASTGPPGSIVVAAKGKRKKNDGRGCAQRGGATSTEPRNLPVESLNLEEVYHSIVAPS
SVGRQKLAFATAFNPPPFARGILNNSNYCFMNATAQALVFLPPFAQLAISAVVEAELCPT
LATLGKWMLSYWARAPNQLVPPLSLPKAVRGQTASSAAPSHWGKMDGSSQEDATEFMHHL
LEVIQTELCALEGSYGDSSTGRIRDPNASLEGNSEKKGWTFVKGRERLSVREHCDKSRSV
LLDAVFGGAVENHLKGKSKLKDHASVLVEGFFILQVDVGFSAECSLEMALERSLQRERVY
DSARAKDLLKTVKLRRLPTVLLLQLQRWAVTAEGELVKLENLVRFSKTLVLPKSTCSDKT
LSNATRTYELVAFIAHRGKATERGHYVTYLANASLPTPTTAQGDAALTFCNDAKVHTVTM
REAIEGEAVYLLVYQRKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgtcaactggtccgccggggtcgattgttgtcgccgcgaaagggaaacga
aagaaaaatgatgggaggggatgcgcacagcgaggcggtgcgacatcaacagagccccga
aatttgcctgttgagagcctgaacttggaagaggtgtatcactcgattgtggctccttcc
tctgtgggtcgccaaaaattagcttttgccaccgccttcaacccgccgccgttcgcaagg
ggaattttaaacaatagcaactattgctttatgaatgcaacggctcaagctttggtgttt
ctaccgccatttgcgcagctagccatatccgcagtggttgaggcggaattgtgtccaacg
cttgccactttggggaaatggatgctttcgtactgggcgagagcccctaatcaattggtc
ccaccgctctctctacccaaggcagtgcgtggacaaacggcctcctcagccgcaccctcc
cattgggggaaaatggatggttcctcacaagaagacgcgacggagtttatgcatcacctg
ctggaggtgattcagaccgagctgtgcgcattggaggggagttatggtgattcttccact
ggcagaattcgcgacccaaacgcttcgcttgaggggaattctgaaaaaaaaggttggacg
tttgtgaagggtagggaacgactctccgtgcgggaacactgtgacaaatcccgctcagtt
ttgttggatgctgtctttggtggcgcggttgagaatcacctgaagggcaaaagcaaactg
aaggatcatgcctcggttcttgtcgagggtttttttatccttcaagtggatgtcggtttt
agtgcggaatgtagtcttgaaatggcgcttgagcggtcattacaacgtgagcgagtttac
gacagtgctcgtgcaaaggatttgttgaagacagtgaaacttcgacgactgcccacggta
ctcctcctgcagttgcagcggtgggctgtgaccgctgagggcgaacttgtcaaactggaa
aacttggttcgcttctccaagacgctggtgcttccaaaatcgacgtgctcagataagaca
ctaagcaatgcaaccagaacgtacgaacttgtcgcctttatcgcgcatcgtgggaaggct
actgagcgtggacattatgtgacatatttggctaatgcatctttgccgacgcccacaacg
gcacagggcgacgcggcgttaacattttgtaatgatgcaaaagtgcatacggttaccatg
cgggaggccatagagggtgaggcggtgtatttacttgtttatcaacgcaagaaatga

DBGET integrated database retrieval system