KEGG   Trypanosoma cruzi: 507785.10Help
Entry
507785.10         CDS       T01012                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tcr  Trypanosoma cruzi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    507785.10
Exosome [BR:tcr04147]
 Exosomal proteins
  Proteins found in most exosomes
   507785.10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 413 aa AA seqDB search
LVLEAEMLPSVMDRYESYDFGKELLSLLKTASSTPGAHMGVFTGMGLLLAKYRPEKLLEH
VNMHAKKINTHKMIAACEEYHLWLVLRVLHVNNEDWLAAATTMMHHHVDAWDHDVFKTVV
SHLGSSDLVYNSISFYIQTNPQLLDDFLTSMFKTLDPERVLLEVKKLAPVHFIRQYLESA
QERNSRRVNEAINKLYMEEEDFTALRDSVERFDNFDSAELSAELEKMELFEFRKIALFLH
RRNKRFTHAVAVAKENKLYQDAIETAAESANPQIVEDLLDFFVVDHPDCFVACLYTCYDY
LTPQVVMEKAWLNKRTDLAMPYFIQVIQDYTTKLSRMEKSMMDAQQLAKEAARRAGPLHT
GANDPLMIQAGPANPMGGAMPMPMPMPMPMPMMGGVPPGNYGPPPQFDNRRPY
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
cttgtactagaagccgaaatgttgccaagtgtcatggatcgctatgaaagttatgacttt
gggaaagaattgctctccctgcttaagacagcatcctccacaccaggggcccatatgggt
gtttttactggaatgggacttctgttggcgaaatacaggcctgaaaaactattagaacat
gtgaatatgcacgccaagaagatcaatacacataaaatgattgctgcatgtgaggagtat
catctgtggttggtgcttcgagttttacatgtcaacaacgaagattggcttgctgccgcc
acgacgatgatgcaccaccacgtcgatgcctgggatcatgacgttttcaagactgttgtg
agtcatttgggatccagcgatttggtgtacaactccatctcattctacatccaaaccaat
ccacaactccttgacgactttctcaccagtatgtttaagaccttggaccccgagcgtgtc
ttgctggaggtgaagaagctcgcccctgtgcactttattcgtcagtatctggagtctgcc
caggaacgcaactccagacgtgtgaatgaggcaattaacaagctatatatggaggaagag
gactttactgctttgcgtgactcggtggagcgctttgacaactttgactccgcagaatta
agtgctgagcttgaaaagatggagctttttgagttccgcaagattgcgctttttctccat
cgccgtaacaagcgatttacacatgccgttgccgtggcgaaggagaacaaactctaccag
gatgccattgaaactgccgccgagagtgccaacccgcagattgtagaggatcttctggac
ttttttgttgtggatcacccggactgctttgttgcgtgtctctacacatgctacgactac
ctcacaccacaggtcgtgatggaaaaggcatggctcaacaagcgtacggacctcgccatg
ccgtactttattcaggtcattcaagactacacaacaaagttatcgcggatggagaagtcc
atgatggacgcccaacaattggcaaaggaggcggcgaggcgggcggggccgctgcataca
ggtgcaaatgaccctctgatgattcaagcagggccagcaaacccaatgggtggcgcgatg
ccgatgccaatgccaatgccgatgccgatgccaatgatgggtggtgtgccgccgggcaat
tacggtcccccgccgcagtttgacaacaggaggccgtactag

DBGET integrated database retrieval system