KEGG   Trypanosoma cruzi: 507873.60Help
Entry
507873.60         CDS       T01012                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tcr  Trypanosoma cruzi
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    507873.60
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     507873.60
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     507873.60
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 282 aa AA seqDB search
MDAFNPISEAQRLQEEQEILERDRKRQQEKEERERRAAQEKEAEERRKREEMERLIEAEK
RRIKQEEEWRKLGTDIIQNLPPVPPSVVSEGLVQAWYLDDETSKPTLRTASLKKGKKRDT
PPVTLQQLKDLGVIYYDINLNDFSIVRQLVKERLYKHTDEVHISQTCKDESFLERWFQEH
FNEDEQIRIVIDGSCYFDVRSKQDKWIRIYAKAGDLFIFAPGLYHRGTLDEDDYVALYRL
FRDSPRFAPFFRSDARAESQKVRLNYLMSLKKGNVAAEIGFR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctttaatcccatctctgaggctcagcggctccaggaggagcaggagatactt
gagcgtgacaggaagcggcagcaggagaaagaggaacgtgagcgacgtgcggcacaagaa
aaagaggcggaggagcggaggaagcgagaggagatggaacgccttattgaggcggagaag
agacgtataaaacaggaggaggaatggcgcaaacttgggacggatatcattcagaacctt
cctcccgtaccaccctccgttgttagcgagggtctggtacaagcatggtaccttgacgac
gaaacctcaaagccaacgcttcgaactgcgagcttaaaaaaagggaagaaacgcgacact
ccgcccgtgacgctgcagcaactgaaggatctcggcgtcatttactatgatataaacttg
aacgacttttccattgtcaggcagttggtgaaggaacgcctttataagcatacggatgag
gtgcatatttcacagacatgtaaagatgagtcttttttggagcgttggttccaagagcac
ttcaacgaggatgagcaaattcgcattgtgattgacggctcctgttactttgatgtgcgc
tccaagcaggataagtggattcgtatttatgcaaaagcgggagatttgtttatttttgca
ccaggtctttatcatcgtggaaccctggatgaggatgactacgttgcactctaccgtctt
tttcgcgattctccacgttttgccccctttttccgctccgacgcacgggccgagtcgcag
aaggtacgtctgaattatttaatgtcactaaagaagggaaatgttgcggcagagattggg
tttcgctga

DBGET integrated database retrieval system