KEGG   Trypanosoma cruzi: 507951.114Help
Entry
507951.114        CDS       T01012                                 

Definition
high mobility group protein
Orthology
K11295  
high mobility group protein B2
Organism
tcr  Trypanosoma cruzi
Brite
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   507951.114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 270 aa AA seqDB search
MSTELKSGPLPADVEEVIANIMREEGVSFLTSKILRLRLEARYRMEFTSHKAAIEGIITK
LMQLPEFKKQLENAVKEEKAASSIGGKKKKRSASAAADERNAKVNKKEKKPDDYPKAALS
PYILFGNDHRDKVKEQNPGMKNTEILQSLGKMWAEASDAVKEKYKKLAEDDKKRFDRELS
EYKKSGGTEYKRGGGKVKAKDENAPKRSMSAYFFFVSDFRKKHPDLSVTETSKAAGAAWK
ALSDDMKKPYEAMAQKDKERYQREMAARAS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgaactaaagtcaggtcctcttccggcagacgtcgaagaggtcatcgcgaat
atcatgcgcgaagagggtgtgagctttctcacaagtaaaattttgcgtctgcgcctggag
gcgaggtaccgcatggagttcacctcgcacaaggctgccatagagggcatcattacgaag
ctaatgcagcttcctgagtttaagaaacagctggagaatgctgtcaaggaggagaaggcg
gcaagcagtatcggtggtaaaaagaagaagcgcagcgccagtgctgcggctgacgagagg
aatgcgaaggtgaacaaaaaggagaagaagccagatgattacccaaaggcggcgctctcg
ccgtacattctctttgggaatgaccaccgtgataaagttaaggaacagaacccgggaatg
aaaaatacggagatcttgcaaagtttgggcaaaatgtgggccgaagcctcggatgcggtc
aaagaaaagtacaagaaactcgcagaagatgacaagaaaagattcgatcgtgaactcagc
gaatataaaaagagtggtgggactgaatacaagcgcggtggcggaaaggtaaaggccaag
gatgaaaatgccccaaagaggtccatgtctgcctacttcttctttgtgagcgatttccgg
aagaagcatcccgacctcagcgtcacggagacctccaaggcagccggcgctgcgtggaaa
gcgctctctgatgatatgaaaaagccatacgaggccatggcacagaaggacaaggagcgg
tatcagagagagatggctgcaagggcgagctag

DBGET integrated database retrieval system