KEGG   Trypanosoma cruzi: 507951.114Help
Entry
507951.114        CDS       T01012                                 

Definition
high mobility group protein
Orthology
K11295  
high mobility group protein B2
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 270 aa AA seqDB search
MSTELKSGPLPADVEEVIANIMREEGVSFLTSKILRLRLEARYRMEFTSHKAAIEGIITK
LMQLPEFKKQLENAVKEEKAASSIGGKKKKRSASAAADERNAKVNKKEKKPDDYPKAALS
PYILFGNDHRDKVKEQNPGMKNTEILQSLGKMWAEASDAVKEKYKKLAEDDKKRFDRELS
EYKKSGGTEYKRGGGKVKAKDENAPKRSMSAYFFFVSDFRKKHPDLSVTETSKAAGAAWK
ALSDDMKKPYEAMAQKDKERYQREMAARAS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgaactaaagtcaggtcctcttccggcagacgtcgaagaggtcatcgcgaat
atcatgcgcgaagagggtgtgagctttctcacaagtaaaattttgcgtctgcgcctggag
gcgaggtaccgcatggagttcacctcgcacaaggctgccatagagggcatcattacgaag
ctaatgcagcttcctgagtttaagaaacagctggagaatgctgtcaaggaggagaaggcg
gcaagcagtatcggtggtaaaaagaagaagcgcagcgccagtgctgcggctgacgagagg
aatgcgaaggtgaacaaaaaggagaagaagccagatgattacccaaaggcggcgctctcg
ccgtacattctctttgggaatgaccaccgtgataaagttaaggaacagaacccgggaatg
aaaaatacggagatcttgcaaagtttgggcaaaatgtgggccgaagcctcggatgcggtc
aaagaaaagtacaagaaactcgcagaagatgacaagaaaagattcgatcgtgaactcagc
gaatataaaaagagtggtgggactgaatacaagcgcggtggcggaaaggtaaaggccaag
gatgaaaatgccccaaagaggtccatgtctgcctacttcttctttgtgagcgatttccgg
aagaagcatcccgacctcagcgtcacggagacctccaaggcagccggcgctgcgtggaaa
gcgctctctgatgatatgaaaaagccatacgaggccatggcacagaaggacaaggagcgg
tatcagagagagatggctgcaagggcgagctag

DBGET integrated database retrieval system