KEGG   Trypanosoma cruzi: 508111.30Help
Entry
508111.30         CDS       T01012                                 

Definition
glutamate dehydrogenase
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
tcr  Trypanosoma cruzi
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:tcr00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tcr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tcr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 416 aa AA seqDB search
MTSLWPFLEKHPEYCQDSLLERLVEPESVVQFRVSWVDDKGEVQVNRAWRVQFNSSIGPY
KGGMRFHPSVNLSILKFLGFEQTFKNSLTTLPMGGGKGGSDFDPKGKSDREVMRFCQALV
TELYRHIGPDTDVPAGDIGVGGREVGYMAGMTQKLTNNKACRFTGKGISFQGSQMRPEAT
GYGVVYFLDALLKKHNQELKGKTVVVSGSGNVAQYAVEKCLQLGAKVLSVSDSRGCVHDA
EGFTPEKLKVLMDIKNVKHGTVEEYAKGLGLQYYAGKRPWHIKADIALPCATQNELELED
AKALIKNGVTVVAEGANMPTTTDATMEFINAGVLFAPGKAANAGGVAISGLEMSQNAARL
SWTAEEVEQKLRDIMNSIHDACVKYGTVGGKTNYVNGANIAGFVKVAEAMKGLGVV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgctttggccttttctggaaaagcatccagagtactgccaggattctcttctg
gagcgcctggtggagcccgaaagtgtcgttcagttccgcgtgtcatgggtggatgacaag
ggtgaagtgcaggtgaaccgggcgtggcgtgttcagttcaactccagcattggcccatac
aagggcggcatgcggttccacccctcagtgaacctgtctattctcaagtttcttggcttt
gagcagacattcaagaactccttgacaacacttccaatgggtggcggcaaaggtgggtca
gactttgacccaaaagggaagagcgaccgtgaagtgatgcgtttttgtcaggctctggtg
acggagctgtaccgccacatcggtcccgatacggatgttccagctggtgacatcggcgtt
ggcggtcgcgaggttggctacatggcaggcatgactcagaaactgacaaacaacaaggcc
tgcagatttacaggcaagggcatttcgtttcaagggagtcagatgcgccccgaggctacg
ggctacggcgttgtctactttttggatgccttgctgaagaagcataaccaggaactgaag
gggaagaccgttgttgtgtcggggtctggcaatgttgcgcaatacgctgttgagaaatgc
ctccaactgggcgcgaaggtgctcagtgtctcagactcacggggttgtgtgcatgacgct
gagggcttcacccctgaaaagctgaaggtcttgatggacatcaagaacgtgaagcacggc
actgtggaggaatacgcaaaagggttggggctccagtactacgcggggaaacgcccatgg
cacatcaaggcggatattgctcttccgtgcgcgacgcagaacgaactggagcttgaagat
gcgaaggcactgataaagaatggtgtcacggttgttgctgagggtgcaaacatgccgaca
acgacggatgcgaccatggaattcatcaatgccggtgtcttgtttgcccccggaaaggct
gccaacgccggcggggtcgccatctctggtttggagatgtcgcagaacgcagcgcgtcta
agctggacagccgaggaggtggagcagaaactccgcgatatcatgaactccatccacgac
gcgtgcgtgaaatatggcacagtgggtggcaagacgaattacgtgaatggggccaacatt
gccggctttgtcaaggtcgcggaggccatgaagggtcttggcgtagtttga

DBGET integrated database retrieval system