KEGG   Trypanosoma cruzi: 508153.130Help
Entry
508153.130        CDS       T01012                                 

Definition
enoyl-CoA hydratase, mitochondrial precursor (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tcr  Trypanosoma cruzi
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    508153.130
   01212 Fatty acid metabolism
    508153.130
  Carbohydrate metabolism
   00640 Propanoate metabolism
    508153.130
   00650 Butanoate metabolism
    508153.130
  Lipid metabolism
   00062 Fatty acid elongation
    508153.130
   00071 Fatty acid degradation
    508153.130
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    508153.130
   00310 Lysine degradation
    508153.130
   00380 Tryptophan metabolism
    508153.130
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    508153.130
Enzymes [BR:tcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     508153.130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 267 aa AA seqDB search
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVS
VLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGC
ELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEA
ERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTF
QATFATDDQKEGMAAFVEKRKPNFKNA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaagagtctgttccttcttaattccatggaccctattgtcaagtacgcccaa
aagggtgctgtggtgacattgacgttaaatcgtcctaaacagctcaatgccctgaatgcg
gagttaacaaatgcactggcggaaaagctgctaaagtgtgacgccgatccatcggtctct
gttttgatcatcactggtgaaggccgatcctttgttgctggcgcagacatcaaagcaatg
gcaaaccaaacttttgtcgaattttacaaacacaacatgcttcgaggccttgatacgatt
gcagcggtccgcaaacccattatcgccgcggtaaacggtttcgcactcggtggcggctgt
gagttggcgatgtcttgcgacattgttgttgccagcgaaaaggccatctttgggcaaccc
gagatcaaaattggaacaattccgggcgcgggtgggacgcagcgactcacacgactcatt
ggtaagagcaaagcaatggaatggattcttacaggtgagcaatacacggccgaggaggct
gaacgcgccgggttggtttcacgcgtcgttaggcatgaggaacttcttccaacggtcagt
gcaatggcagaaaaaatcgccctgaacagcccattagctgtttctttggccaaagactgc
atcaacaaggcattggagacaacgctggcgcaaggtatggcctatgagcagcgcaccttt
caagccacctttgccacggatgatcagaaggagggcatggctgcgtttgtggagaagcgc
aagccgaattttaagaatgcgtga

DBGET integrated database retrieval system