KEGG   Trypanosoma cruzi: 508231.30Help
Entry
508231.30         CDS       T01012                                 

Definition
phosphatidylinositol 3 kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tcr  Trypanosoma cruzi
Brite
Protein kinases [BR:tcr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   508231.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 2432 aa AA seqDB search
MESCVHPLIGQLQPIFNELHSSTAATLPSVILKLEYIIGDEGDTFFQGSAGGEFRASHSG
LSNWVNTQIKDLFSKSETQLAGILCTKALLGTDYIGSNSLLQFFLQLLEGSVRSSDVVVS
EKSAEVWGLLLNNSGSFAEGTAQTRLKTCIKDLRMTGDEVDKVAASLFLCQLLKHTPSTV
VPYLDLVFEGIRVALRDLSERVRVNAACVLQYALSVMYTSMGSSTVIKLLDSFLGDSLNG
LESKKKDLQHGAILCFNAVLFSITNGTSSYGAAVVLSSASVSYLHEIWQCVNAKIVNPSL
LLEIRRELLNSLILLASYDTVKFRERSIPVVLAAASTVFRVATCREEHSMMFLAMGKLAA
ILRDHVTLFLDRMMPHIQAALGQKSKDDRCLEAVTCFATLAEVSPKAARPYLRQILALLF
SFPPTVGFTRDIARICEAFPELRSTCLSKILEATKQQLLNAHHRLSISTGENDADAVLSL
ESLSALSSLDFSGYSTLPFLCDAVICYVSFPHEELRRAAINLCFKLLLSGCTGSQLPCGR
TPEGVVVHHGRDHTRLINTIVSKLVNAAVSDPESDIRLHTLESFTEEYDHALALQHVVSS
LFPALHDKHQNRLAVVRLLGRVSRRNPAHIYPMLRKIMVQCLTEIQFFEHAKKQEQAFSL
LGAIVESTPDFSKPYVPSLLNSCVKRLREPSQTAAVLTALLSCIGKLVRYAEGDDVRVAA
EIRPVVVQHILDSSHLPKKREALRALGDIIRTTRDVNIFEVHPELLSVLLQALHGGFKET
WPVRNDVLQLMGIIGAVDPIRVKEILRNSHVNDSNTEMVPSFGLRGEDSIAQTVVRSVLQ
ILSLPSLTDEQSVGAVNVIVKIISLREVSSSGLIPYHAEIISLILKHARLQVRKREDILI
CLTSFVSHIKEYVRPYLDELTLAVASFISASDISVLNQTLALVKQLRRCFREEFRPYLSS
LLIPILNLVEESPHAAGENVFGFLSEMGSLLEDHLDNVLPVVCDVIVNASFSNTSRVAAV
ETLRSFAQQLPSLRFHASRCVHCLCRVLKEQGGVKATARGSLGSAAITALLAIAQNLGKT
FENFTPIVFPVVAGHYGEMDGEYKRFCGILRDTINTRKNPEMQRCQEENNSGGTIASRSG
TNSDKLPAERPSDPFETLRHVLRNWVRSNDEDWNHWLTQLAVILLRSSPSPSHGCALTLA
ELHDPFARQMLYSAFATCYSEMNESTRKDVVGLLSEVLRGPRVPSEVLQELLNLSEYMER
LEIRQNAHGNGCRNASQDFRLFDLPTLMESSERCNLYSKALHYVEIEFFETIREYERSVF
RGIPRPLPSGVWQNLLQLCEKSIYLCNLLGQRESANAVLKFIQQNYSMLTGQEVTELFQM
MDARLFDKLQWWSQSYRAYERRLRQENNKISNMVGLMKALDALGSYPEVLNLWKQYSVQV
SKKEVVELAPMGAHAAWLLRCWDDMENITSFMSEDSYIGTTAVFYRAVLATRKRQFREAD
RLIKLCRKRLDSNLSALVAESYDRAYELFVGIQQLSELEELAMAARDVRNVGRWQELWEK
RLGSMAYEGWPGTLANHTLLVPPAQELDMWLRFVSLSRANGRERVSNDVLHELLGNQSIE
SAVANQMLQPAVALGAFQHLYETNRKKKAIEMLEQYVEKVEQMGTQHANRAREELAICHA
KLAEWLTHRKKSHSFAETLRSALHHLRCATDLDNKNGTIWHTWARLHHEAAMKNISGKVS
PSVEDHIVCAIDGYLRSVCLSQELEDTLGFLSLWFMHASLPSIQGSSTIKAGIHQVSPTV
WLKVIPQIIARIYSRDAVIAEYAYHLMVIIAKSHPQAILYSLNVANTSHQMKVSSECVER
QKGTQRVLARIAEFHHNGKTMVNDAALACRELVRCAVLWPELWFDELERVWFQWGKDKNA
NNVLSALNPLLEQLKMPETMAESHFAMEFGQLLTEAFGYVEKSALLDSEGYMEEAWSRFK
TAVKRMDDQINGMSSLALQLVSPRLLQNGKNLSLVVPGQYKENGSYPRIASFRGALKVMN
SKQRPRRIYINGSDGNLYKFLLKGHEDLRLDERVMQLLGFANKILEKHLVTKRRGCLIQT
YSVTPLSDNAGLVGWVDHCDTLHQIIKEYRIHPKYLSTELNLMRSMSDELHHLTVIQHVE
PFELALERTEGDDLVRSLWMKAPSAETWLERRTTYVCSLATMSMVGHILGLGDRHPSNLM
IHAFSGRVVHIDFGDCFEVAKQRSNYPEKVPFRLTRMLVKAMEMGGIEGLFRHGCIVVMG
VLREEGSSLLALLEAFVHDPLVSWWRDEGGNDRCTNNKDNAKQSTSMTGSLRASHEEYDV
GSVHGTQRSLHRRGAISRVCIQGEEIALQQTRKAQSVVNRIKEKLEGFDFFHDRPSRGDD
GLTVEEQVSRLIQEATSNENLCVHFSGWCPFW
NT seq 7299 nt NT seq  +upstreamnt  +downstreamnt
atggaaagttgtgttcatccgttgataggccagctgcagcccatcttcaatgaactccat
tcaagtactgctgccacactaccatctgtcatattaaaactagagtacatcattggtgac
gaaggcgacacgttttttcaaggcagcgcaggaggggaatttagagcctcacattcagga
ctttcaaactgggtcaacacgcaaatcaaagacttatttagtaaatctgaaacgcaactt
gcagggatcttatgcaccaaggctcttttgggcactgattacattggaagtaacagtttg
ttgcagttttttttgcagttactggaagggtctgtaaggtcgtccgatgtggttgtgtcg
gaaaagtcagctgaagtgtggggtcttttactgaacaacagcggtagctttgcggagggc
actgcccagactcggttgaaaacatgcatcaaggacctacggatgacgggggatgaggtg
gacaaggttgctgcctctctgtttctatgccagctgttaaaacatactccgtcaactgtc
gtgccttatctcgacctagtgtttgaggggatccgtgtggctttgcgcgatttatcagaa
cgtgtgcgagtgaatgctgcatgtgtcttgcaatatgcgctttccgtgatgtacacctcc
atgggttcgagtaccgtaataaaattgttggatagttttttaggggattcactcaacggt
ttggaatccaaaaaaaaggacttgcagcatggtgccattttgtgttttaacgctgtactt
ttttctataacgaatggcacctcttcttatggagcggcggtggttctttcttctgcctcc
gtctcgtacctgcatgaaatatggcagtgtgttaacgcgaaaattgtcaatcccagtctg
ttgctggagattcgacgagagcttttaaactcactgattcttcttgcatcctacgatacg
gtaaagtttagagaacgatccattcccgttgtactcgcagctgcatctacggtttttcgg
gtggcaacatgtcgtgaagagcattcaatgatgtttcttgcaatggggaagctggcggcc
atattacgggatcatgtgactctttttcttgaccgtatgatgccgcatatccaggcggca
cttgggcagaaatccaaagatgatcgttgcctagaggctgtaacatgttttgcgacccta
gcagaggtgagccccaaggctgcgcgaccgtatctgcgacagatcttggctctactcttt
tcttttcctccaactgtggggtttacgagggacattgcacgaatttgtgaggcttttcca
gagctacggtccacttgtctatcgaaaatattggaagcgacgaaacagcaacttttaaat
gcacatcaccggctatcaattagtaccggtgagaacgatgccgatgccgttctttcccta
gagtctttgagtgctctgagcagtctggatttttctgggtattctaccctgccatttctc
tgtgatgctgtcatttgttatgtgtcttttcctcacgaagaattacgccgggctgcgata
aacctttgctttaaacttctcctttctgggtgtacaggttcccagttgccatgtggacgg
acaccagagggtgttgttgttcatcatggtcgtgaccacacgcggcttattaataccata
gtaagcaaacttgtgaatgctgctgtttccgatcccgaaagtgatattcgtctacatacg
ctggaaagcttcacagaggaatatgatcacgcattggctcttcagcatgttgtgagctcc
ctttttccggccttgcacgacaagcatcaaaacaggttagcagtggtgcggttgctgggc
cgtgtttcacgtaggaatccggcacacatttatcccatgttgaggaaaattatggtacag
tgcctgacagagatacaattttttgagcatgcaaagaagcaagaacaagcgttctctctt
ttgggggccatcgtggagtctacacctgacttttccaaaccatacgtgccatccttgctt
aacagctgtgttaaacgtttacgcgaaccttctcaaacagctgcggtattgacagcactg
ctatcgtgtatcggaaagcttgtacgctatgcggaaggtgatgatgttcgtgtcgctgct
gaaatacgtcctgttgttgttcagcatattttggactcttctcatttgccaaagaaacgg
gaagcgttacgagctcttggcgacattatccgcacaacaagagatgtgaatatttttgag
gttcatcccgagcttctttctgttttgcttcaggcactgcatggtggattcaaggagacg
tggcctgtgagaaacgacgtgcttcagcttatgggaattattggtgctgtcgatcccatt
cgggtaaaggaaattctgcgaaattcacatgtaaacgacagtaacactgagatggtacct
tcctttgggttgaggggtgaggattccattgctcagaccgtcgtacgcagcgttctacag
attctttctctgccttctttaacggatgaacaaagtgtgggtgctgtgaatgttattgtg
aagattatttcattgagggaagtttcttctagtggtctcattccgtaccatgcggagatt
atctcattgattttaaaacacgcacgcttgcaggtacgtaaacgtgaagacattttgata
tgtcttacctcttttgtttcacacatcaaagaatacgttcgcccataccttgatgaactc
acgttagccgttgcctcctttatctcagcatccgatatctccgttctcaatcagactctt
gcgctggtgaagcagcttcgtcgttgttttcgtgaagaatttcgtccgtacttgtcttcg
ttactcattcccattcttaatctcgtggaggagagcccacatgcagccggtgaaaatgtg
tttggatttctttcagagatgggatcacttctggaggatcatcttgacaacgttttgcct
gtggtgtgcgacgtcattgtgaatgcatccttttcaaatacgtctcgggtggcggcggtg
gagacacttcgaagttttgcacaacaactccctagtcttcgttttcatgcctcacgctgc
gttcattgtctttgtagggtcttgaaggagcaggggggcgtgaaggcaactgcacggggt
tcattgggaagtgctgccatcacagctcttcttgccattgcgcagaacttagggaaaaca
tttgaaaattttacaccaatcgttttccctgtggttgcagggcactacggagagatggat
ggggagtataagcgattctgcggcatcttgcgggataccattaacacaagaaaaaatcca
gagatgcaacgatgtcaggaagaaaacaatagtggtggtacgatcgcctcacgctccgga
actaacagcgataaattacccgcagaacggccatcggatccctttgaaaccttacgacat
gtactacgaaattgggttcgttcgaacgacgaggactggaatcactggctgacgcagctt
gcggtgattcttttacgctcaagtccatcgccctcccatggttgtgcccttactttagcc
gagctacacgatccttttgcgcgtcaaatgctatactccgcctttgccacttgttacagt
gaaatgaatgaaagcacgcggaaagatgtggttggtctattgagcgaagtgctgcgtgga
ccgcgggtgccctccgaggttttgcaggaattacttaacttgtctgaatacatggagcgt
ctcgagattcgtcagaatgcacatggcaatggatgtcgcaatgcctcgcaggattttaga
ctttttgacctccccaccttgatggagagcagtgaacggtgcaacttgtactcgaaggcc
cttcactatgtggaaattgagttttttgagaccattcgagaatatgagcggagtgttttt
cgaggtattccacgtccgcttccttctggagtgtggcaaaacttactgcagctttgtgaa
aagagcatttatttatgcaatcttcttgggcagcgagagagcgcaaatgcagtgttaaaa
tttatccagcagaattattcgatgcttaccggacaagaggtaaccgagctctttcagatg
atggacgcaagacttttcgataagttacaatggtggtcacaaagctatcgagcctatgaa
agacgtttaagacaggagaacaataagatttccaacatggtggggttaatgaaggcgttg
gatgcgctcggaagttatccggaggtgcttaatttgtggaagcaatattctgtccaggta
agtaaaaaagaggttgtggaattggctcccatgggagctcacgccgcatggcttttaaga
tgctgggatgatatggaaaacatcactagttttatgagtgaggatagttacattggtacc
acagccgtgttttacagagccgtacttgcaacacggaaaagacaatttcgtgaggcggat
agacttattaagttatgtcgcaaacgactagactccaacttgtcagctcttgtggcggag
agctacgatcgagcatatgagctttttgttggcattcaacagctcagtgaattagaagag
cttgccatggcagcacgtgatgtgcggaatgtgggccgttggcaggagctttgggagaag
cgactgggatctatggcttacgaagggtggcctggcaccttggccaatcacactcttttg
gtgcccccagcgcaagaattggatatgtggcttcgttttgtcagtcttagtcgtgcaaac
gggcgagagcgtgtttctaatgatgttttgcatgaattacttggaaaccagtcgattgag
tctgctgttgcgaatcagatgcttcagcccgcggttgctttaggggcctttcagcacctt
tacgaaaccaatcggaagaagaaggcaattgagatgttggaacagtatgtggagaaggtg
gagcagatgggaactcaacacgcgaatcgggcgcgagaagagctggcaatttgccacgcc
aagttagccgaatggttaactcaccggaaaaagtcacatagttttgctgaaacattacga
agtgctctccatcatctgcgctgtgccacagacttggataataaaaatggaacgatttgg
catacgtgggctcgtcttcaccatgaagcagccatgaaaaacatctctggtaaggtgtct
ccaagtgttgaggatcacattgtgtgtgccattgatggatatctccgaagtgtttgtctt
tcacaggagttggaggatactcttgggtttttgtcgctttggtttatgcatgcatctctt
ccatcgattcaaggaagctcaaccattaaggcgggtatccatcaagtcagtccaacagtg
tggctcaaggtaatccctcaaattattgctcgcatctattcacgtgatgcggttattgcg
gaatatgcctatcatcttatggtcatcattgccaaatcacatcctcaagctattctttat
agcttgaatgttgcgaatactagccaccaaatgaaggtatcgtctgagtgtgtggaaaga
caaaagggaacgcagcgtgtgcttgcacgaatcgcagaattccatcacaatggaaaaaca
atggttaatgatgctgctttggcttgccgtgaattggtgcggtgtgctgttttgtggccg
gaactctggtttgacgagttggagcgggtatggttccagtgggggaaagacaaaaatgcc
aataacgttttatccgcgctaaatcccttactggagcaactcaaaatgcctgaaacaatg
gcggaatctcattttgcaatggaatttggtcaacttcttaccgaagcctttggttacgtt
gaaaaatctgccttattagactctgaaggctacatggaagaggcgtggagtcgatttaag
acagcggtgaaaaggatggatgatcagatcaatggaatgtcctcgctggctttgcagttg
gtgagtccacgcctgttgcagaatggaaagaatttgtctcttgttgttccggggcaatat
aaagagaacggcagttacccacgaatcgcttcttttcgaggcgccttgaaggtcatgaac
tcgaaacaacgcccgcggcgcatatatattaacggctctgacggaaatctctacaagttc
ttattaaagggtcatgaagacctccggttggacgaacgagtaatgcaattactgggattt
gcaaacaaaattcttgaaaaacacctggtgacgaaacgtcgaggctgtcttattcaaact
tattctgtaacaccacttagtgataacgccgggcttgttggttgggtggatcattgtgat
acactccaccagatcattaaggagtaccgaattcatccaaagtatctcagcacagaactc
aacctaatgcgaagcatgtctgatgaactacaccatctcactgttattcaacatgttgaa
ccatttgagttggcattggaaaggacggaaggtgacgatcttgtccgttcgctgtggatg
aaggcccccagcgcggagacatggcttgaaagacgaaccacctacgtctgttctctcgcc
accatgtctatggtaggccacattctgggtcttggcgatcgtcacccgtcgaacttgatg
attcacgcattcagtggcagagttgtgcacatagattttggtgactgttttgaagttgca
aaacaacgtagtaactacccagagaaggtgccatttcgccttacgcgtatgcttgttaag
gccatggagatggggggcatagagggtctttttcgccacgggtgcatcgtggtgatgggc
gttttgcgcgaggagggtagcagcctactggctctgttggaggcgtttgtacacgatcca
cttgtgtcttggtggcgtgatgagggaggaaacgacagatgcacaaacaacaaggataat
gcgaagcagtctacttcaatgacaggttcactgcgtgccagtcatgaggagtatgatgtg
gggagtgtacacggaacccagagatccctgcatcgtcggggggcaatctcgcgtgtatgc
atccagggagaggagatagcactacagcagactcgaaaggcccagagtgttgtgaatcgt
atcaaggagaaacttgaggggtttgacttttttcatgacaggccaagtcgcggcgatgat
ggccttactgttgaggagcaggtttcaagactgattcaggaggccacttccaatgagaat
ttgtgcgttcatttctcgggttggtgcccattttggtag

DBGET integrated database retrieval system