KEGG   Trypanosoma cruzi: 508257.230Help
Entry
508257.230        CDS       T01012                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tcr  Trypanosoma cruzi
Brite
Protein kinases [BR:tcr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   508257.230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 2592 aa AA seqDB search
MTDAAEPSIDRFFKESASALGRQFSIIFRNLQSAPESRLRRVNECLSDLLDLLVAHTKEI
IELGLLDHIFQLVNETFDGSVKRGIQALRVVFDAHLGDQHEERSRCVALLMRQAARGKCE
EDCAFMLNELGEVLQENVRSTSDMLGRHLNRAIVMMRQGATVHERAVGCQILATMVETSS
SVIKRNPALLDSLNATCSPLFLLRETVESFSMWHRHALVGLLKNIVEKHCIEISPFMATQ
MSAVMTEFMENADENVIIVGLLTAIETVAASPTLQSAPWHLKKIHSFLMERDWNTYPKEV
CIMVPRATGKALLLFRDDEGLYYGIMRCFLSYLSDWEEDVAVVALSTLYDILGEVNIAPH
VELAVDVIAHFIVKFPFYQLPFDALERLRAQCGEQSVARIYTLFDIIGIDMEYTNLQKLS
ALLRFMGDRKQSIWERFRLLQIDISPHVPVDVLVRALPFLATLGRTEQIGELIDLMFHEN
LKVRQAAVDAVVILCEKLILQSRSNDNIHQLTQRLDNTVTSAVGKLLDVAVADRDAELRY
NVLCRFSPLFDAYLSLQDHLDALLMARNDVSRRARDRTLVLLCRLHPCNPAIVHSQLLRQ
QEYMLREIEAKDGSMSAAIYQASLLQMTAEHDRLLLQPRTVELAVLARLQREPFASKSFS
VALLNLLRLILDRTGPHNHCDANQLLQPVIHIVNGSTSSRRRKAALETLCSILTTIRVTK
QSSYVVVYLALARIIRSEAEEDEGVNYAAMKALSVIGAVNPVKLRFILKALEDDEIEEAE
EVVTSALACYKPRMRVHPHMTERYPSIVLYLLVKTLQQSADPEQQAGTIATINSMVREIP
GNQKAILLTHFLPQLQSWLADPERDHLYEGILLLMTELATLLRQFKDVIPSNTGSELLHS
VRQFCLLPQASQKPLNAGVVELLDEVARGLSAQEMRDHRWAVEFIHQRLSQDKNDLDLVL
RAVKSLESFLAVLHEKDLQVVLPHVLQCIEPEDATPSALRPKAKDINAACFDFLNQIMVK
QPLLVKDCCAEIVHTVMWYIEKSKSQDEMEMGFNTLAFLVEVVNRQAKRFILPIRRLAEQ
KGFSEAMFTDLLNSAARGFLKVRVPVTKQDKLDPDLPLSVVSHLPGLSRKDFEEEMMNTL
NLGGDDFEVMDVSHPSGQTIINLRFFGGDDSAANFRSFTRKAQETQSVLRRNLGILKLDQ
TQLNECKVDEALLQKIATIPVANKKKREQSWIAWLHKTSVEMLANSQIQPLRCTAELAKY
NSDLSRDLFSFAAAAFIAQLDKNQRALVMDTFTRALEMSPNDIKQILFGFAEFFESERGK
NELVLVKRIETMNCVVEREDTEKKFGINYDQNARGIAVTKLEPNGPGAKAGVPVGALLVA
INGKKVSAVSEIVSNIRGEKKISLTLKYEVEEQRKPESEPLMDLEVLARVAFDSQMHAKA
IFLNEVLFDQLFNGLGEQVSGRQDAAVRSALQVAERLIEFYDHLGLNMVAKGLVKKMSAK
FSGKIIAPEQFGFDEVGALEQLNWWGEALARYESRMMNTDGSINTSSLLGVLRCLDALGE
AIEMEVLINRNWHQLDRESRFEVAPLKAKVALSLGRWQQFDELTEQSGVMERLGMVERCA
TLFRQRQYEELLEFTKERRESLFDLFSESFMESYNRAYDMLVELQHLRHFEELVSFVNSG
EERQRMLKELWQTRLAHMSSRPAQVKTLITINSLVLTPAMDLTSQVMCIRALSKSQWTSF
ADHMLNLLLGPTGDYQALCRQDPDVIHVYMKHCYTTKNRRETLRLLSEILARLQVSPGDD
RAEAWGSCWLLLGEWTMHLFPDKGDEAIEQLKKATELCPRNHLAFHSLGILHYDMSRDPN
TPVEVQTAHHVGSITALFKSVELSSNQGNGVMEDVLRILSIWFSHSALLEINEAIKEGID
RVPDYVWLKVIPQLVARIGITAKVARSILTELLVRVGSKYPHALIYPLTVTEKSPEAIRQ
LMAERVLKGIRVSNGPMVGEASLISNEMVRIAILWAEKWHSHIQQAAGKQNDVNAILRIF
GPLFWELENPKTPNECAFEKTYGPTLRHAKAALQNNTLDQAWSLLKQVYVQLNKTTGERR
LLMGDLSPTLGGIKESIVAVPGSFVLGQPLITIQKFHQAVIVMPSKQKPRRFGLDASNGQ
KYRFLLKGHEDLRQDERVMQFIEFVNTIFFADSSSSAIGLSIPQYAVIPLTDNVGIIGWV
ENTETIYRMLETRRKEHSISIYEEVRMIVRNGALRNIEEYHHQSKEQRKNLLSQVFNNTP
DNELRRIIWDKNDTCEQWLEYRGTYGHTLAIMSMVGYVLGLGDRHLNNLMLQEKGSVVHI
DFGDCFEVAMHRSLYAEAVPFRLTRLLVSALGISGVDGVYRLTCELVMKNLRRHCENLLS
ILEAFIYDPLINWRLANVGDGERSSSRAEAHVKTGDNTLLNPGETNTKEPQMQLSYSVAR
VREFVACATLDQLNEEETRNMQGDLALARVRAKLTGEDFDAMNGSSVLQNSRREFCDESG
DASSCGSQSYGDSQKDSFAIGNPALTTYLSLRAVNGSANCLDVPHQVDRLIQEATSLDNL
AEAYITGWAPFW
NT seq 7779 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcagcggagccttccattgaccgtttcttcaaggagagcgcttctgctctg
ggaagacagttttcgattatttttcgcaacctgcagtccgcaccggagagtcgcctgcgg
cgtgtgaacgaatgcctctccgaccttctggacctcctggttgcccacaccaaggagata
attgagctgggccttctggaccacatttttcagcttgtgaatgagacatttgatggctcc
gtcaaaaggggcatacaagccctccgtgttgtgttcgacgcacatcttggcgatcagcat
gaagaacgatcccgttgtgtggctcttctcatgcggcaggcggcacgagggaagtgcgag
gaggattgcgctttcatgttgaacgaattgggtgaggtgttacaggagaatgtccgttcc
acctccgacatgttgggtaggcacctgaaccgtgccattgttatgatgcgacagggggca
actgtgcatgagagagcggtgggatgtcaaatacttgccacaatggtggaaacaagctcc
agtgtcattaagagaaatccggcgcttttggacagtttgaatgcaacctgttctccactt
tttctactgcgggagacggttgaaagtttttccatgtggcatcgacacgctcttgtaggt
ttgcttaaaaatattgttgaaaaacactgtattgaaatttctccttttatggcaacacaa
atgtctgctgtgatgacggaatttatggaaaacgcagatgaaaatgtgattattgtaggt
cttttgacagccattgaaacagtggcggcatcccctacgcttcaaagtgcaccgtggcac
ttaaaaaagatacattcgtttttgatggagcgtgattggaatacgtatccaaaagaagta
tgtatcatggttccacgagccactggcaaagcccttcttttgtttcgagacgatgaggga
ctttactacggaattatgaggtgctttttgtcgtacctttcggattgggaggaagacgtt
gcggtggttgctctttccactttatacgacattctcggtgaagtaaatattgcgccacac
gtggaattggctgtggacgtgattgctcattttattgtcaagtttccattctaccagctt
ccgtttgacgcattggagcgtctgcgagcacaatgtggggaacagagtgtggccagaatt
tatacgctttttgacatcattgggattgacatggagtatacaaacctgcagaagcttagt
gcattgctgcgattcatgggggatcgcaaacaatccatttgggagcgttttaggctgctt
cagattgacatttcgcctcatgttccagtggatgtgttggtgcgtgctctgccgtttctg
gcgacgcttggccgcacggaacaaataggggaattaattgatttgatgtttcacgagaat
ttgaaagtgcggcaagcggctgttgacgctgttgtgattctctgcgaaaaacttatttta
caatccaggagcaatgacaatatccatcaactgacacagcgactcgacaacacagttaca
agcgctgtggggaagctgctagatgtggccgtggcagatcgcgatgcggaacttcgctac
aacgttttatgccgtttttcccctctgtttgacgcatatctctctcttcaggatcatctg
gacgctctcttgatggcgcggaatgacgtttctaggcgggcgcgggatcgaacgctggtt
ttattgtgtcgtttgcatccttgtaaccctgccattgttcactcccaattgctacgccaa
caagagtacatgctacgtgaaattgaggcgaaggatggttcgatgtccgctgccatttat
caggcatcgctcctgcagatgacggcagaacatgacagactgctgttgcaaccccggaca
gtagaacttgctgttttggcacgtttgcagcgagaaccgtttgcctctaaaagtttttcc
gttgctttgttgaatttgttacgactcattttggaccgcaccgggcctcataatcattgt
gatgccaatcaacttcttcagcctgtgattcatattgtcaatgggagcacctcctccaga
cgtcgcaaggctgcactggagacactgtgctctattttgacgaccattagggtaacgaaa
cagtccagctatgtcgttgtttatctcgcgctcgcacgcattattcgatccgaggcggag
gaggatgaaggggtcaattatgccgcaatgaaggctctgagtgtaattggggcagtgaat
cccgtcaagctaagattcatcttgaaagccctagaagacgatgaaattgaggaggcggaa
gaagtggtgacatctgccttagcgtgctataaaccacgtatgcgtgtacatccacacatg
acagaacgctatccctctattgttctttatttactggtgaagacgttgcaacagagcgca
gatcctgagcagcaggcgggaacgattgccaccatcaattccatggtacgtgaaattcct
ggcaaccaaaaggcgatactcctgacgcactttcttccacaacttcagtcgtggcttgct
gatccggaacgagatcacttatatgagggcattcttcttcttatgactgaattagccacc
ctgctacgacaattcaaggacgttataccatcaaacacaggctctgagctccttcactcg
gtgcgacagttttgtttgcttccacaggcgtcacaaaagccacttaatgcgggtgtcgtg
gagttactcgatgaggtggcccgaggactctctgcgcaagagatgcgggatcatcgttgg
gcggtggagttcattcaccaacgtttgtctcaggacaaaaacgatttggacttagttctt
cgtgctgtgaagtcattggagtcgtttttggcggttttgcatgagaaggatctccaagtg
gttctaccgcatgttcttcaatgtattgagccagaggatgcaacgccgtcggccttgcga
ccaaaggcaaaagatatcaacgcggcctgctttgattttttgaaccaaattatggtgaag
cagcctttgttggtaaaggactgttgcgctgaaattgtgcacaccgtcatgtggtacatt
gaaaaatctaaaagtcaagatgagatggagatgggctttaacacccttgcctttcttgtc
gaggtggtgaatcgtcaggcgaagcggtttattctccccatccggagacttgcagagcaa
aaaggcttttcagaggccatgttcacggacttgctgaactcggccgcccggggctttttg
aaagttcgcgttccggtcacgaaacaggataaactcgaccctgatttgcccctcagcgtc
gtgtcccacctgccagggctttcgcgaaaggactttgaggaggagatgatgaacacactc
aatctcgggggcgacgattttgaggtgatggacgtctcacacccgagcggtcaaacaatt
attaacctccgcttttttggaggcgacgactcggcagcaaacttccgctccttcacacga
aaggcgcaggaaacgcagtccgtcctaagacgtaaccttggtattttaaagttggatcaa
acgcaattgaatgagtgtaaggtcgatgaagcgcttctgcaaaagattgcgactatccca
gttgctaacaagaagaaacgtgaacaatcttggattgcctggctgcataaaacatctgtg
gagatgcttgccaactctcagattcagcctttgcgttgcacagccgagcttgccaaatat
aacagtgatctgtcacgggatttgttttcatttgcggcggcggcctttattgcgcaacta
gataagaaccaaagagcacttgtcatggacacctttactcgtgctttggaaatgtctcca
aatgacattaaacaaatactgtttggctttgcggagttttttgaatctgagcgtgggaag
aacgaattggtgcttgtgaaaaggattgagacaatgaattgtgtggttgagcgagaagac
accgagaagaagtttgggattaattacgatcaaaacgccagaggcattgcggttactaaa
ttggagcccaatggcccgggcgccaaggcgggagtgcctgttggggctcttttagtcgcc
atcaatgggaagaaggtctcggctgtcagtgagattgtttcaaacattagaggggagaaa
aaaattagtcttacattaaagtatgaggttgaggaacaacgaaaaccggagtctgaaccg
ctgatggaccttgaagtactggcgcgtgtagcctttgattctcaaatgcacgctaaagcc
atatttttgaatgaggtgctgttcgatcagctctttaatgggttgggtgagcaggtttcc
ggtcgtcaggatgctgcggtccgctcggctctgcaagtggcagaacggcttattgaattt
tacgatcacctggggttgaatatggttgcaaagggtctagtgaagaaaatgtctgccaag
ttttctgggaaaatcattgcaccggagcaatttggctttgacgaggtaggggcattggaa
cagttaaattggtggggtgaagcattagctcgctatgagtctagaatgatgaacacggat
ggatccattaacacatcttccctactaggggttttgcgctgccttgacgcgttgggtgaa
gcaattgaaatggaggtccttatcaatagaaactggcaccagctagaccgggagtcccga
tttgaggtggcccctctaaaggcgaaggtggcgctttctttgggaaggtggcagcagttt
gatgagttgacggaacaatcgggggtgatggagcgattggggatggtcgaacgctgtgcg
acattgtttaggcaaaggcaatatgaggaacttcttgagttcacaaaggagcgcagggag
tcactttttgatttattttcggagtccttcatggagagttataaccgggcatatgacatg
ttggtggaattgcagcatctgcgacattttgaagagcttgtgtcctttgtgaactctggg
gaggagcgtcagaggatgctaaaggaattgtggcagacacgtctggcacacatgtcgtct
cgtccagcacaagtgaagacccttatcacaataaattctcttgtgcttactcccgcaatg
gatttgacgtcgcaggtgatgtgcatacgcgctctgtcaaagtctcaatggacatccttc
gcggatcacatgttgaatttgttgcttggacccacaggggactatcaggctctatgccgt
caggatccagacgttatacacgtctacatgaaacactgttacacaacaaagaatagacgt
gaaacattacgcttgctttctgaaattctcgcgaggttgcaggtatcgcctggggatgat
cgtgcggaagcttggggttcctgttggcttttattgggtgaatggacaatgcatctgttc
cctgataagggggacgaggcgattgagcaactgaagaaggccaccgaattatgccccaga
aaccacttggcatttcattcattgggtattttgcactacgatatgtctcgagatcccaat
acgccggttgaggttcagaccgcacatcatgtgggttcgatcaccgcactcttcaagtcg
gtggaactgtccagcaatcagggcaatggcgtgatggaggatgtgttgcgaatactttcc
atttggttttctcacagtgcgctgctggaaatcaacgaagccataaaggaagggattgac
agggtcccagattatgtgtggctgaaggtgatcccgcaactcgtggctcgcattggaatc
acagcaaaggtggcgaggtcgattctaacagagctgcttgtgcgcgttggatccaaatat
ccacatgcccttatttatcccttgacggtgacggaaaagtctccagaggccatccggcaa
ctgatggcagagcgtgtgctgaagggcatccgggtctcgaatgggcccatggtgggtgaa
gcatcgttgatcagcaatgagatggtgcgtattgccattttgtgggcggagaagtggcac
agccatattcagcaggcggcgggaaaacaaaatgacgtaaatgccattctccgcattttt
ggtccgttgttttgggagttggagaatccaaaaacccctaatgaatgcgcctttgagaag
acatacggtccaacactgcgacacgccaaagcggcgttgcaaaacaacaccctcgatcag
gcgtggtctttacttaagcaggtgtatgttcagctaaacaaaaccacaggggagcgaaga
cttctaatgggggatttgtccccgacactagggggcatcaaggaaagtattgtggccgtt
cccggctcttttgtacttggccagccactgatcacaatccaaaaatttcatcaagctgtg
attgtcatgccatcaaaacagaaaccacgtcgttttggattagatgcttccaacgggcag
aagtatcgcttcctcttgaaagggcatgaggatttgcgacaggatgaacgtgtgatgcag
tttattgaatttgtcaacaccattttttttgcggacagttcttcgagtgccattggtctt
agcattccccagtacgccgtcattccgctaacagacaatgtcggtataattggctgggtc
gaaaacacagagactatataccggatgttagaaacacggcggaaggaacatagcatttct
atttacgaggaggttcgcatgattgtaaggaatggagctttgcggaacattgaggagtac
catcatcagagcaaagaacaacgaaagaacctgttaagccaagtctttaataatacacct
gataatgagttgagacgcattatttgggacaaaaatgatacgtgtgagcaatggttagag
taccgcggaacgtatggtcataccctagcgattatgtcgatggttggatacgttctggga
cttggggaccgccatctgaacaatttgatgcttcaagaaaagggatctgttgtgcatatt
gacttcggtgactgttttgaagttgccatgcaccgttcactctacgcggaggccgtaccg
tttcgcctgacacgtcttcttgttagcgcccttggcattagtggggtcgatggggtttat
cgcttgacgtgcgagcttgtcatgaagaacttgcgacggcactgtgagaatcttctttct
attcttgaggcctttatttatgacccgcttatcaactggcgtcttgcaaatgttggcgac
ggcgaacggtcgtcctcgcgggcggaagctcatgtgaagacaggtgacaacactctcctc
aacccaggggagacaaacacgaaggagccgcaaatgcaattgtcatactctgtggcgcgg
gtacgtgaatttgttgcgtgtgcgacattagatcagctaaacgaggaggaaacgcgtaac
atgcagggtgatctggcactcgcccgcgttcgcgccaagctgacaggggaagactttgat
gcaatgaatgggagctctgttttgcagaattcccgtcgcgagttctgcgacgaatccggt
gacgcctcctcgtgcggctcgcagagttatggagattcccagaaagactcattcgcaatc
ggtaacccggcgctgacgacatatttgtctctgcgggcggtgaatggaagtgccaactgc
ctggacgttccacaccaagtcgatcgactcatccaagaggccacaagcctggacaatctc
gctgaagcctatatcaccggttgggccccattctggtaa

DBGET integrated database retrieval system