KEGG   Trypanosoma cruzi: 508369.50Help
Entry
508369.50         CDS       T01012                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tcr  Trypanosoma cruzi
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    508369.50
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    508369.50
   00640 Propanoate metabolism
    508369.50
  Lipid metabolism
   00061 Fatty acid biosynthesis
    508369.50
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    508369.50
Enzymes [BR:tcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     508369.50
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     508369.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 871 aa AA seqDB search
PESSEDVVLTTPSKLTENTNDFSSGPKDKGNGSNGTNNNHNSNLAPRTLLRTLSKLEALR
NLLPSRDKMETPGPETSDEIEESLPLGPYPMVSSKQLKRLQARSLKTVYVHDWPLLLETV
LRNQWEKHASGRGFSWKCIPKEVLRAKELFLDASDGKTLCEKRPLGHIPCGMIVWLVTIV
PPTYYDSDTDTAGIRRIVMVANDIAFQSGSFAVPEDDVFSAASELARRLRVPFVYISANS
GARLGLSVEVKKRFRVALSETNELEYLYLLPEDYEELMRLGVRLSVEPRQEKDGNGETRY
VIRGIVGAPDEYLGVENLRGSGLVAGQMSKNYSEVPTISVVTGRSVGIGAYLNRIGRRVI
QTDDAPLILTGAGALNRLLGKEVYSDNGQLGGKRIMVPNGVTHWCTKNNYSSAEALLCWL
NYVPPTVDPLRCCPRVLALPNYDPVDRDVTFMPKGGEAYDPRHLVCGVGDRLGLFDRGSW
TESLEGWAKSVVTGRATLGGIPCGIILVETRMTRKHDPADPADPTSASSFIPQAGQVWFP
DSARKTADALDDFHHERLPCFILANWRGFSGGMRDMFDEVLKFGASIVDNVRVYNCPLFI
YIPPCGELRGGAWVVVDPSINHNGVVEMYCDPTSRGGVMEASGVVEIKFRENDVRELIRR
SNPHLAALDHQRLRDEENRLLPLYRDVAIRFADLHDTHFRMQATGAVRGVVPWKDSRRLF
HAKLQRKLKELSVAVSMVEAKEVGSISEGVRKIEAAFAQDHPDIPWGTNDALHMQWLTEK
VELNGVFLSGVSLLPPSPAISLPSPLTAVEEVTRLTAQCQGTDALENCFESLFEDENMLK
AAMGAMQRIRDRAEKVGKLTFTEAEMASKPE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
ccagagagctcagaggacgtcgtcctcacaaccccatccaagttaactgaaaacaccaac
gacttttcttctggcccaaaggataagggcaacggttccaatggcaccaataacaatcat
aacagtaaccttgcacctcgtactctcttacgcactctgtcgaagctggaggcgctgcga
aacctgcttccttcacgtgataagatggagacgccggggcccgagacgagcgatgaaatt
gaggaatctctcccgttggggccgtatccgatggtctcttcaaaacaactgaagcgcctt
caggcaaggtccctaaaaaccgtctacgtgcacgactggccactgctgctggaaacagtg
ctgagaaatcaatgggagaaacatgcatccgggcgaggcttctcatggaaatgtattcca
aaggaggtgctcagggcgaaggaactttttcttgacgcttccgacggcaagaccctctgc
gaaaagagaccgctgggacacatcccatgtggaatgattgtgtggctggtgactattgtt
cccccaacgtactacgacagcgacacggacaccgccggaattcgtcgtattgtgatggtt
gccaatgacattgcgtttcagtccggctcttttgccgttccagaggatgacgttttctct
gcggcctccgagctggcccgaagattacgtgtgccttttgtgtacatcagcgccaacagt
ggggcgcgacttgggttgagtgtggaggtaaagaagcggtttcgtgtcgccctgagtgag
acgaatgagttggaatacttgtatctcttgcccgaagattacgaggagctgatgcggctt
ggcgtgcggttatcggtggagccaaggcaggaaaaagacggcaacggtgaaacgcgttac
gttatccgcggcattgttggtgcaccggatgagtatttgggtgtggagaacctgcgcggc
tccggccttgtggcggggcagatgtctaaaaattacagcgaagttccgaccatcagcgtt
gtgacgggacgcagcgttggtatcggagcatacttgaaccgcattggccgccgtgtgatt
cagacagacgatgcaccactcatcttgacaggcgccggggcactcaaccgtcttcttgga
aaagaggtgtacagcgacaacggccagctcggtggaaagaggataatggtgccgaatggc
gtgacgcattggtgcacgaagaacaactacagctctgcagaagccctgctgtgctggctc
aactacgtcccacccactgtggatccgctgcgatgctgcccgcgtgttctcgcactgcct
aactatgatcccgtggacagggacgtcacgttcatgccaaaaggaggtgaagcgtacgac
ccacggcacttggtttgtggtgtgggtgataggttgggtttatttgaccgcggctcgtgg
accgagtcattggagggttgggcgaagtccgttgtgacggggcgggcaactcttggtggt
attccatgtgggatcattcttgtcgagacgcgaatgacgcgcaagcatgaccctgctgac
cctgcggacccgacgtctgcctcatccttcattccgcaggcggggcaggtgtggttcccc
gactccgcacgcaagacggcagatgcgcttgacgactttcatcacgagcggcttccatgc
tttattttggcgaactggcgcggtttctcaggtggaatgcgagacatgtttgacgaggtg
ctcaagtttggtgcctccatcgtcgataatgtccgtgtctacaactgtcctctctttatt
tacattcccccctgcggtgagctgcggggcggggcgtgggttgtcgttgacccttccatc
aaccacaacggtgtggttgagatgtactgcgatcccacctcccgcggtggcgtgatggag
gcgtctggtgtcgtggaaatcaaattccgggaaaacgatgtacgggagctcatccgtcgc
agtaacccacaccttgccgcattagaccatcagaggcttcgagatgaagagaaccgcctg
ctgccgctttaccgcgatgttgccattcgcttcgcagatctacacgacacccattttcgc
atgcaggccacgggtgccgtgcggggcgtggtaccgtggaaggatagcagacgcctgttt
cacgccaaactgcagcgcaaactgaaggaactgtcggtggcggtctcgatggtggaggcg
aaagaagttggttccatttccgagggagtccggaaaattgaggcggcttttgcgcaggat
catcccgatattccgtggggaactaatgatgcgctgcacatgcagtggcttacagaaaag
gtggagttgaatggtgtctttttgagtggcgtctcgttattaccgccgtcaccggcaata
tcgttgccgtcgcccttgactgcggttgaagaggtgacacgtctgacggctcaatgccag
ggaaccgatgcgttagaaaattgttttgaaagcctctttgaggatgaaaatatgctgaag
gctgcgatgggggccatgcagcgaatacgggaccgtgcagagaaggtagggaagctcacc
tttactgaggctgagatggccagcaaacccgagtaa

DBGET integrated database retrieval system