KEGG   Trypanosoma cruzi: 508375.30Help
Entry
508375.30         CDS       T01012                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tcr  Trypanosoma cruzi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    508375.30
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    508375.30
Enzymes [BR:tcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     508375.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 326 aa AA seqDB search
MLELPPVASLKGKSITSAEQFSRADIYALIHLASAMQRKIDAGEVLNLLQGRIMTPLFFE
DSSRTFSSFCAAMIRLGGSVVNFKVEASSINKGETLADTIRTLDSYSDVLVMRHPRQDAI
EEALSVAQHPILNAGNGAGEHPTQALLDTLTIHSELGSVDGITIALIGDLKMGRTVHSLL
KLLVRNFSIKCVFLVAPDALQMPQDVLEPLQHEIATKGVIIHRTHALTDEVMQKSDVLYT
TRLQKERFMASTSDDAAALQSFAAKADITIDAARMRLAKEKMIVMHPLPRNDELSTTVDA
DPRAAYFRQMRYGMFMRMAILWSVLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttggaactgccgccagtagcgagcctgaagggcaaaagcatcacaagtgccgagcag
ttcagtcgtgcggatatctacgcgctgattcatcttgcaagcgccatgcagcgtaagatt
gatgcgggtgaggtgctgaatctcctgcagggccgcatcatgacgccacttttttttgag
gattcctctcgcaccttcagttccttttgtgccgcgatgattcgacttggtgggagcgtg
gtgaactttaaggtcgaggcgtcatccatcaacaagggcgagaccctcgccgacaccatt
cgcacactggactcctacagcgacgtgctggtgatgcggcatccaaggcaggacgcgatt
gaggaggccctttccgtggcgcagcatcccattctgaatgcgggtaatggggctggcgaa
cacccaacgcaggcgcttctggacacgctgacgattcattcggaattgggcagcgtagac
ggcatcaccatcgcgctgatcggagaccttaagatggggcgaacggtgcactctcttctg
aagcttcttgtacgcaacttttcgattaaatgtgtgtttcttgtcgccccggacgcactg
cagatgccgcaggatgtgctggaacccctgcaacacgagatcgccacgaagggagtgata
attcaccgcacacacgcactgacagatgaggtcatgcaaaagagtgatgtgttgtacaca
acgcgtctgcagaaggaacggtttatggcttccacgagcgatgatgcggcggcgttgcag
tcatttgcggcgaaagccgacatcaccatcgacgcggcacgtatgaggctggcgaaggaa
aaaatgatcgttatgcacccacttccacgcaatgacgagttaagcactaccgttgatgca
gacccacgtgctgcctactttaggcaaatgcggtacggcatgtttatgcgcatggccatt
ttgtggagcgttttggcgtga

DBGET integrated database retrieval system