KEGG   Trypanosoma cruzi: 508479.350Help
Entry
508479.350        CDS       T01012                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tcr  Trypanosoma cruzi
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tcr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 228 aa AA seqDB search
MNDDYDNFDEYNDAADDWEAEAAEEEAREKEILEQKANIEEQKLKKRIKAPAKVKKEEEE
EETIAADIAAALITMKEKASSAGEAMHLLGDGDEGARRLIADMPVKTEQDATELGEAIAK
RLLTFSRLPHFNTMLAVVFQDFAQEFRTLYAANMEATRVHVSSEEAKRRIKKAKKAKGSN
HHDDAATIETTVNKEPDIEKKDRDALDFDAVNDAGGAAGVSIEEEDFM
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgattacgacaactttgatgagtacaacgacgctgccgatgattgggaagca
gaagcggcagaagaggaagcacgtgaaaaggagatactcgaacagaaggctaacattgag
gagcagaaacttaagaaacgcattaaggcccctgcaaaagtgaagaaggaagaggaagag
gaagagacaattgcagcagacatagcagcagctcttattacgatgaaagagaaggcgagc
agtgcgggagaggcgatgcatttattgggggatggggacgagggtgcacggaggctcatt
gcggatatgcctgtgaaaaccgaacaagatgcaacagaacttggagaagccatcgcgaag
cggctgctgactttttcccggctgccacactttaatacgatgcttgctgttgtgtttcag
gattttgctcaagaatttcgaacactttacgctgcaaacatggaggcgacaagggtgcat
gtatccagcgaggaggcgaagaggcgaatcaaaaaagccaagaaggcaaagggaagcaat
caccacgacgacgctgccacgatagaaaccaccgtcaataaggagccagatatcgaaaag
aaggatcgtgatgctttggattttgacgcggtaaatgacgctggcggtgcggctggtgtt
tcaattgaggaggaagactttatgtga

DBGET integrated database retrieval system