KEGG   Trypanosoma cruzi: 508479.350Help
Entry
508479.350        CDS       T01012                                 

Definition
(RefSeq) hypothetical protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
tcr  Trypanosoma cruzi
Pathway
tcr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    508479.350
Ribosome biogenesis [BR:tcr03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    508479.350
Translation factors [BR:tcr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    508479.350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 3553659
NCBI-ProteinID: XP_820835
GeneDB: Tc00.1047053508479.350
UniProt: Q4E2I5
AA seq 228 aa AA seqDB search
MNDDYDNFDEYNDAADDWEAEAAEEEAREKEILEQKANIEEQKLKKRIKAPAKVKKEEEE
EETIAADIAAALITMKEKASSAGEAMHLLGDGDEGARRLIADMPVKTEQDATELGEAIAK
RLLTFSRLPHFNTMLAVVFQDFAQEFRTLYAANMEATRVHVSSEEAKRRIKKAKKAKGSN
HHDDAATIETTVNKEPDIEKKDRDALDFDAVNDAGGAAGVSIEEEDFM
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgattacgacaactttgatgagtacaacgacgctgccgatgattgggaagca
gaagcggcagaagaggaagcacgtgaaaaggagatactcgaacagaaggctaacattgag
gagcagaaacttaagaaacgcattaaggcccctgcaaaagtgaagaaggaagaggaagag
gaagagacaattgcagcagacatagcagcagctcttattacgatgaaagagaaggcgagc
agtgcgggagaggcgatgcatttattgggggatggggacgagggtgcacggaggctcatt
gcggatatgcctgtgaaaaccgaacaagatgcaacagaacttggagaagccatcgcgaag
cggctgctgactttttcccggctgccacactttaatacgatgcttgctgttgtgtttcag
gattttgctcaagaatttcgaacactttacgctgcaaacatggaggcgacaagggtgcat
gtatccagcgaggaggcgaagaggcgaatcaaaaaagccaagaaggcaaagggaagcaat
caccacgacgacgctgccacgatagaaaccaccgtcaataaggagccagatatcgaaaag
aaggatcgtgatgctttggattttgacgcggtaaatgacgctggcggtgcggctggtgtt
tcaattgaggaggaagactttatgtga

DBGET integrated database retrieval system