KEGG   Trypanosoma cruzi: 508647.200Help
Entry
508647.200        CDS       T01012                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    508647.200
   01230 Biosynthesis of amino acids
    508647.200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    508647.200
   00051 Fructose and mannose metabolism
    508647.200
   00562 Inositol phosphate metabolism
    508647.200
Enzymes [BR:tcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     508647.200
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   508647.200
  Exosomal proteins of bladder cancer cells
   508647.200
  Exosomal proteins of melanoma cells
   508647.200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 251 aa AA seqDB search
MASKPQPIAAANWKCNGSESLLVPLIETLNAATFDHDVQCVVAPTFLHIPMTKARLTNPK
FQIAAQNAITRSGAFTGEVSLQILKDYGIKWVVLGHSERRLYYGETNEIVAEKVAQACAA
GFHVIVCVGETNEEREAGRTAAVVLTQLAAVAQKLSKEAWAHVVIAYEPVWAIGTGKVAT
PQQAQEVHELLRRWVRSKLGADIAAQLRILYGGSVTAKNARTLYQMRDINGFLVGGASLK
PEFVEIIEATK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaagcctcaacccatcgccgccgcaaactggaagtgcaacggctccgagagt
ttgcttgtcccactcatcgagacgctcaatgcagcgacttttgatcacgatgtgcaatgc
gtggttgcgcccacctttctccacatcccaatgacgaaggcgaggctcaccaaccccaag
ttccagattgccgcacagaacgcgatcacaaggtcgggcgctttcacgggggaagtctct
ctgcagatcctcaaggactatggaatcaagtgggttgtgttgggccactcggaacggcgt
ttgtactacggcgaaacgaacgaaatcgttgcggaaaaggtggcgcaggcctgcgctgcc
ggcttccatgtcatcgtctgcgttggtgaaaccaacgaggagcgggaagctggccgcacg
gcagccgtcgtgttgacgcagctcgccgccgtcgcgcagaagcttagtaaagaggcgtgg
gctcacgtcgttattgcctacgagcccgtgtgggcaatcggcaccggtaaagtggcaacc
ccgcagcaggcgcaggaggtccatgaattgctgcgccgttgggtgcggagcaaattgggc
gctgacatcgccgcgcaactgcgcatcttgtatggcggatccgtgaccgccaaaaatgca
cgcacgctctatcagatgcgcgacatcaacggcttccttgtgggtggtgcctcgctcaag
ccggagtttgttgaaatcattgaggccacgaagtag

DBGET integrated database retrieval system