KEGG   Trypanosoma cruzi: 508815.110Help
Entry
508815.110        CDS       T01012                                 

Definition
serine/threonine protein phosphatase catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tcr  Trypanosoma cruzi
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    508815.110
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     508815.110
Protein phosphatases and associated proteins [BR:tcr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     508815.110
Transcription machinery [BR:tcr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     508815.110
Spliceosome [BR:tcr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    508815.110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 303 aa AA seqDB search
MSLDVDAIIDKLLGVRVSKPGKQVNLAENDVKNLALRSREILLAQPALLELEAPIKICGD
IHGQYYDLLRLFDNGGFPPSANYLFLGDYVDRGKQGLETICLVLAFKVKFPENFFLLRGN
HECASINRIYGFFDECKRRYNIRLWKAFTDTFNCLPVACIIDDKIFCCHGGLSPELQTMD
QIKRIARPCDVTDAGLICDLLWSDPEEGLSGWGENDRGVSYTFGQDIVEKFLRKHEFDLI
VRAHQVVEDGYQFFAKRQLITIFSAPNYCNEFDNSGAVMSVDADLLCSFQILKPSVKKPK
FYQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagacgtggatgccatcattgacaaactgttgggcgtccgcgtgtcgaagccg
gggaaacaagttaatttagcagagaatgatgttaaaaatcttgcactacgaagccgagag
atccttttggcgcagcctgctcttttggagcttgaggctcccattaaaatctgcggggat
atccacggacaatattacgatcttctccgcctgtttgacaatggcggctttccaccctcc
gccaactatctctttcttggcgactatgtagaccgcgggaaacaagggctggaaaccatc
tgtcttgtgcttgcattcaaggtgaaatttccggagaacttttttctgcttcgcggcaat
catgagtgcgccagcattaatcgcatttatgggttttttgacgaatgcaaacggcggtac
aacattcgcctctggaaagccttcacagacacttttaactgtctccctgttgcctgcatt
attgatgacaagatattttgctgtcacggtggtctctctcccgagctgcagacgatggat
cagatcaagagaattgcacgaccttgcgatgtcactgacgctggtctcatctgtgacctt
ctgtggtcagaccctgaggaaggcctttctggctggggcgagaatgaccgtggtgtctct
tatacatttggtcaagatatcgtagagaaattccttcggaagcatgagtttgatcttatc
gttcgtgcacatcaagtagtggaggatggctatcaattctttgcgaaacggcaactcatt
acaattttttccgctcccaactattgtaatgagtttgataacagtggtgcggtcatgtcg
gtggacgcggaccttctctgctcattccagatcctgaaaccatcggtgaagaagccaaag
ttctaccagtag

DBGET integrated database retrieval system