KEGG   Trypanosoma cruzi: 508851.189Help
Entry
508851.189        CDS       T01012                                 

Definition
phosphoenolpyruvate mutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tcr  Trypanosoma cruzi
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:tcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     508851.189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 299 aa AA seqDB search
MRHCCGLPQKARMLKSMLRSKELSFMMEAHNGLSARIVEETGFKAIWASGLSISAQMGFR
DNNEASWTQVCDVAEQMSDATSIPILLDADTGYGNFNNARLLVRKLEKNGVAGACVEDKL
FPKTNSLLDERGAQPLADVKEFALKIRAMKDTQTDENFCVVARVESFIAGWPLEEALKRA
TAYAEAGADAVLIHSKKKDSSEIDAFMGHWDNKTPVVIVPTSYASVPCAHFREIGISTVI
WANHNLRACIAAMQASTRMIFEQESVVAVGKNIASVKEVFRLQRLPEYLEAEEMYLPKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcactgctgtggtctgccacagaaggcaaggatgttaaagtccatgctgcgctcc
aaggagctgagtttcatgatggaggcgcacaacggtctttccgcccgcattgtggaggag
acgggatttaaggcaatttgggcctcgggtctctcgatatccgcccaaatggggttccgc
gacaacaacgaagcgagttggacgcaggtgtgtgatgttgccgagcagatgagtgatgcg
acaagtattcccatcctgctggacgccgacacgggctacggaaacttcaacaacgctagg
ctgctcgtgcggaagctggagaagaatggtgtagccggtgcctgcgtagaggacaagctc
ttccccaagacgaatagtctgctggatgagaggggggcacagccgctcgcggatgtgaag
gagtttgcgctgaagattcgcgccatgaaggacacacaaaccgatgaaaacttttgcgtt
gtggcacgcgtcgagtccttcattgctggctggccactggaggaggcattgaagcgtgct
acggcgtatgccgaggcgggtgccgacgccgtactcattcatagcaagaagaaggactcc
tccgagattgacgccttcatgggccattgggataataagacgcccgttgtcattgtgccc
accagctacgccagcgtcccgtgcgcccacttccgcgagatcgggattagcaccgtcata
tgggcgaaccacaacctgcgggcctgcattgccgccatgcaggcctcgacgcggatgata
tttgagcaggagtcggttgtagcggtggggaagaacattgcgtcggtgaaggaggtcttc
cgactgcagcgacttcccgaatatcttgaggcggaggagatgtacttgccgaagaaataa

DBGET integrated database retrieval system