KEGG   Trypanosoma cruzi: 508857.160Help
Entry
508857.160        CDS       T01012                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    508857.160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    508857.160
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    508857.160
Enzymes [BR:tcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     508857.160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 663 aa AA seqDB search
MFNLCVMGSAPATVKEQVERALLAAFVPARFMLTRLEDVKEGEDHGRVMSQSFRLLLEAH
DAPPTNPQEMPYDCRFFWTPESTTEEVVTEVKSLLDGRRFISTRGVVGISTNFLSVVRDG
LAPNSGLFNLQSIPQMAMSQMRHFFTTSTLSYVEGAQIVLERLVDTTMQPEKLRILLMEA
YAPCRWSGLSDVCPVTPLLLDEPDNNKAMEGHHHGANKETGAAADPCWRDMSLMELYHGP
TAAFKDFALQLFPRYFDIAASNECTDTPPSYVILTATSGDTGVAAISGFVNAGSPTRVMV
LYPLHGVSPVQQIQMLSYDNGVSVRVYGVKSDFDFCQSTVKQLFAKRSLAQRLWSDKKIR
LSSANSINWGRLVPQVAYYFWAYRQFVQKKRLQFGDPLDIVVPCGNFGNILAAFFAKRMG
LPLGKLVVASNCNDVLFEFVETGHYDIRQRHLVQTASPSIDILKASNVERLLFLISNGDA
AFVAAQMHRLETEKHFTLQGGALNAMRDVFWSARCTEAECAATIKEVYEASAGRLLDPHT
AVAVFVARQFRRFQLEKGLSHRPLVIASTAHWAKFPRSVLRALRGEEMAYGITNSVGGQV
NPVRACRELYDEILAHCPGATVHPALNAALAAAEANAFSPREIEADVSRVEEELLQFVSV
NSA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatctctgtgtgatgggctcggccccagccactgtcaaggagcaggtagagcga
gccctgctggccgcgttcgttcccgcgcgatttatgttgactcggttagaagatgtaaaa
gaaggagaggatcacggccgtgtaatgtcacaatcgtttcgacttcttctcgaggcacac
gacgctcctcccacgaacccgcaggagatgccatatgactgtcgctttttctggacgccc
gaaagcacaacggaagaagttgttacggaagtgaagtcgctgcttgacggtcgccggttc
atctcaacacgcggcgtggtaggcatatcaaccaactttctgagtgttgtgcgggacggt
ctggcgccgaatagcggcctctttaaccttcaaagcatcccacaaatggcaatgtcgcaa
atgcgtcacttttttacgacttccacgctgagttacgttgagggggcacaaattgtgctg
gagcggcttgtggacaccaccatgcagccagaaaaactacgcattttactcatggaggca
tacgcgccttgtcggtggagtggactgagtgacgtgtgccctgtcacgcctttgctcctc
gatgagcctgacaataataaagccatggagggtcatcatcatggcgctaacaaagaaacg
ggtgcagcagccgatccatgttggcgtgacatgtcattgatggagctctaccatgggcct
acagcagccttcaaggactttgctctgcagctcttcccccgttactttgacattgcagca
tccaacgagtgtaccgacaccccgccctcgtacgtcatactcacggcaacttctggtgat
acgggtgtggctgccatcagcggctttgtgaacgccggaagccccacgcgcgtcatggtg
ttgtaccccctccacggcgtatcccctgtgcaacaaattcaaatgttgtcctacgataat
ggagtatctgtgcgcgtttacggggtgaagtcggactttgatttttgtcagtccaccgtg
aagcaactgttcgccaaacgatcgctggcgcagcgactgtggagcgacaaaaaaatccga
ctctcttccgccaatagcatcaattggggtcgtctcgtgccgcaagtggcatattacttt
tgggcgtaccgtcaatttgtgcagaagaagcgtctacaatttggcgatcctctagacatt
gttgtcccgtgtggaaattttggtaacatccttgcggccttctttgcaaagcgcatgggg
ctgccgctcggcaagttggtggtggcctcaaactgcaacgatgtgctctttgagtttgta
gagactggccattacgacattcgccagcgacacctggtgcaaacggcatcgccttctatt
gatattttaaaggcctccaacgtggagcggcttctctttttgatctcaaatggagatgcg
gcatttgtggcggcgcaaatgcatcggctggagacggagaagcacttcaccttgcagggg
ggcgcactgaatgccatgcgggacgttttctggtccgcacgctgcaccgaggcggagtgt
gctgcaacgatcaaagaagtgtatgaggcctcagccggccgcctgctggacccacacact
gccgttgctgtctttgtggcgaggcaatttcgtcggttccagctggagaagggtctgtcg
catcgtccgcttgtcatcgcgagcacggcccactgggccaaatttcctagatccgtgctg
cgtgcgctgcgtggtgaagaaatggcgtacggcatcacaaattcggtcggagggcaggtg
aaccccgtgcgtgcctgcagagagttgtatgatgagattcttgcgcattgcccgggcgcc
acagtccaccctgcgctgaacgccgcactggcagcagccgaagcgaatgcgttttcaccc
cgtgaaattgaggcagacgtgtcccgtgttgaagaggagctcctgcagtttgtctccgtg
aattctgcctga

DBGET integrated database retrieval system