KEGG   Trypanosoma cruzi: 508857.160Help
Entry
508857.160        CDS       T01012                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00260  Glycine, serine and threonine metabolism
tcr00750  Vitamin B6 metabolism
tcr01100  Metabolic pathways
tcr01110  Biosynthesis of secondary metabolites
tcr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    508857.160
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    508857.160
Enzymes [BR:tcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     508857.160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 3546965
NCBI-ProteinID: XP_815280
GeneDB: Tc00.1047053508857.160
UniProt: Q4DLL4
AA seq 663 aa AA seqDB search
MFNLCVMGSAPATVKEQVERALLAAFVPARFMLTRLEDVKEGEDHGRVMSQSFRLLLEAH
DAPPTNPQEMPYDCRFFWTPESTTEEVVTEVKSLLDGRRFISTRGVVGISTNFLSVVRDG
LAPNSGLFNLQSIPQMAMSQMRHFFTTSTLSYVEGAQIVLERLVDTTMQPEKLRILLMEA
YAPCRWSGLSDVCPVTPLLLDEPDNNKAMEGHHHGANKETGAAADPCWRDMSLMELYHGP
TAAFKDFALQLFPRYFDIAASNECTDTPPSYVILTATSGDTGVAAISGFVNAGSPTRVMV
LYPLHGVSPVQQIQMLSYDNGVSVRVYGVKSDFDFCQSTVKQLFAKRSLAQRLWSDKKIR
LSSANSINWGRLVPQVAYYFWAYRQFVQKKRLQFGDPLDIVVPCGNFGNILAAFFAKRMG
LPLGKLVVASNCNDVLFEFVETGHYDIRQRHLVQTASPSIDILKASNVERLLFLISNGDA
AFVAAQMHRLETEKHFTLQGGALNAMRDVFWSARCTEAECAATIKEVYEASAGRLLDPHT
AVAVFVARQFRRFQLEKGLSHRPLVIASTAHWAKFPRSVLRALRGEEMAYGITNSVGGQV
NPVRACRELYDEILAHCPGATVHPALNAALAAAEANAFSPREIEADVSRVEEELLQFVSV
NSA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatctctgtgtgatgggctcggccccagccactgtcaaggagcaggtagagcga
gccctgctggccgcgttcgttcccgcgcgatttatgttgactcggttagaagatgtaaaa
gaaggagaggatcacggccgtgtaatgtcacaatcgtttcgacttcttctcgaggcacac
gacgctcctcccacgaacccgcaggagatgccatatgactgtcgctttttctggacgccc
gaaagcacaacggaagaagttgttacggaagtgaagtcgctgcttgacggtcgccggttc
atctcaacacgcggcgtggtaggcatatcaaccaactttctgagtgttgtgcgggacggt
ctggcgccgaatagcggcctctttaaccttcaaagcatcccacaaatggcaatgtcgcaa
atgcgtcacttttttacgacttccacgctgagttacgttgagggggcacaaattgtgctg
gagcggcttgtggacaccaccatgcagccagaaaaactacgcattttactcatggaggca
tacgcgccttgtcggtggagtggactgagtgacgtgtgccctgtcacgcctttgctcctc
gatgagcctgacaataataaagccatggagggtcatcatcatggcgctaacaaagaaacg
ggtgcagcagccgatccatgttggcgtgacatgtcattgatggagctctaccatgggcct
acagcagccttcaaggactttgctctgcagctcttcccccgttactttgacattgcagca
tccaacgagtgtaccgacaccccgccctcgtacgtcatactcacggcaacttctggtgat
acgggtgtggctgccatcagcggctttgtgaacgccggaagccccacgcgcgtcatggtg
ttgtaccccctccacggcgtatcccctgtgcaacaaattcaaatgttgtcctacgataat
ggagtatctgtgcgcgtttacggggtgaagtcggactttgatttttgtcagtccaccgtg
aagcaactgttcgccaaacgatcgctggcgcagcgactgtggagcgacaaaaaaatccga
ctctcttccgccaatagcatcaattggggtcgtctcgtgccgcaagtggcatattacttt
tgggcgtaccgtcaatttgtgcagaagaagcgtctacaatttggcgatcctctagacatt
gttgtcccgtgtggaaattttggtaacatccttgcggccttctttgcaaagcgcatgggg
ctgccgctcggcaagttggtggtggcctcaaactgcaacgatgtgctctttgagtttgta
gagactggccattacgacattcgccagcgacacctggtgcaaacggcatcgccttctatt
gatattttaaaggcctccaacgtggagcggcttctctttttgatctcaaatggagatgcg
gcatttgtggcggcgcaaatgcatcggctggagacggagaagcacttcaccttgcagggg
ggcgcactgaatgccatgcgggacgttttctggtccgcacgctgcaccgaggcggagtgt
gctgcaacgatcaaagaagtgtatgaggcctcagccggccgcctgctggacccacacact
gccgttgctgtctttgtggcgaggcaatttcgtcggttccagctggagaagggtctgtcg
catcgtccgcttgtcatcgcgagcacggcccactgggccaaatttcctagatccgtgctg
cgtgcgctgcgtggtgaagaaatggcgtacggcatcacaaattcggtcggagggcaggtg
aaccccgtgcgtgcctgcagagagttgtatgatgagattcttgcgcattgcccgggcgcc
acagtccaccctgcgctgaacgccgcactggcagcagccgaagcgaatgcgttttcaccc
cgtgaaattgaggcagacgtgtcccgtgttgaagaggagctcctgcagtttgtctccgtg
aattctgcctga

DBGET integrated database retrieval system