KEGG   Trypanosoma cruzi: 508859.90Help
Entry
508859.90         CDS       T01012                                 

Definition
phosphatidylinositol 3-kinase 2
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tcr  Trypanosoma cruzi
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Chagas disease (American trypanosomiasis)
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tcr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tcr04070]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:tcr05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 1055 aa AA seqDB search
MSSPSELFEGLKVDFREELEAEDIYGSKNSEGFERLFERSEKCKRNVTQLSTILQSLIFQ
ENEIETEGELEAIIEYIVGTGLYGQSSSLEAKEFRKKIRASFEYEWHEFQKENSFISSSR
AMRTLPYRFSLPSLEKAQLEMLTELSSRGMSNGSLGTVLLRIWYIDLVGCTCSTLRGFPF
DMKASDAILITMERLFLITNFDKSKSQGIMYVFKIQGRKEYVYGDEILINFCYIRDSVTQ
QREVNVVVEPHEKTLLTDPIFVPSYSYFSKTSDENHHVFYKSESPDDISTGISVWDIEGK
LVVKIGENLCNLVFTSERAKEEGVREGDLLYLALLVEVYHGAKLVCRPQMTKWTVCNDLV
ASNELTTSSSVNWGKETKLTFDMLVSNAPREIKLCISLLATCGERFCSVNSLSAEEIVQK
AEERIGVKKMEECHLSPVFFLGYASVQVFDYMACMQTGKLDMRLWSTKKKANPMCPIPKN
SNKNDMGFSLIFPSFNKPVVIPNVAPPDSKRRDWEQQLLDSDLCLVGNLRESKIEQLRQL
KRILASDPLTELTTIDKVLLWKHRGELILRPRALAKFLLAVNWLRPYAVYEAHTILPQWA
PLQPMDALELLDIRYADIVVREHAVKYLNGMTDYELKGCVLQLVQVLKHEPYHDSALFRF
LLRRSLQSPHMIGHYVFWYLVSEMENTSVSERYGLLLEELIRRMPERKVYLRQLYLADQL
FECAMRVKDAPKKDRIDCLREHLQGLRLPRRFTLPINPAMECSGLDIGKCKVMDSKKFPL
WLVFRNYQEEGDPFYVIFKAGDDLRQDLFTLQLLELMDSLWKSCGLYLHIIPYGCITTGE
GVGMIEVVLNSDTVANITRKYGGAQAAFREEPLMNWLRQFNRERDEVERCLWNFICSVAG
YTVATYVLGIGDRHNDNIMLRQDGTLFHIDFGHFLGNFKTKFGIKRETAPFIFTPMYVYM
LGGQSSPIYLYFVDLACHAFNVVRRFGGTLMTHFMLMLSTGIPELQKIEDIGWLRTVLLI
DRSSEEAREHYRLQIALATSNFRTLFNDYIHIMTH
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccccagcgaattgtttgagggtttgaaagtcgattttagggaagagctggag
gcggaagatatttatggttccaaaaactctgaagggtttgagcgactctttgagaggagc
gaaaaatgtaaacggaatgtaacacagctttctactattctccaatctcttatctttcag
gaaaacgaaattgagactgaaggtgaacttgaggctattatagaatacattgtgggcact
ggtttatatggccagagtagcagtcttgaggccaaggagttcagaaagaagattcgtgcc
tcgtttgagtatgaatggcatgagtttcaaaaggagaactctttcatctcctcttctcgg
gctatgcgtactttgccatatcgcttttccctgccttctctcgaaaaagcacagcttgaa
atgctgaccgagttgagttcaagagggatgagtaacgggagcttgggtacggttttgctt
cgtatctggtacatagatcttgttggttgtacctgttccacattgcggggatttccgttt
gacatgaaggcttcagatgcaatactgatcacaatggaacgcctgtttttgattacaaat
tttgacaaaagtaaaagccaaggaatcatgtacgttttcaaaatacagggacgaaaggaa
tacgtttatggggatgaaatattgattaatttttgctacataagggacagtgtgacacag
cagcgggaggtaaatgtggttgttgagccgcatgagaagacacttctaactgaccctata
tttgtgccttcgtactcgtacttcagcaaaaccagtgatgaaaatcaccatgttttttat
aaaagtgaatctcccgatgacatctccacaggaattagtgtttgggatattgaaggtaaa
ttggtagtcaaaattggagagaatctctgtaatcttgtctttacttcagagagagcaaag
gaagaaggtgttcgcgaaggcgatttattgtatcttgcattgcttgtagaagtttaccat
ggtgccaaattggtttgtcgacctcagatgactaagtggacagtgtgtaatgatttggtt
gcgtcgaatgagcttactacttcttcctctgttaattggggaaaggaaacgaaactgaca
tttgatatgctagtttctaatgcccctcgagaaatcaaattgtgtattagtctgttggcc
acctgtggggaacgcttttgtagtgtgaattctctcagcgccgaagaaattgttcaaaaa
gcagaagagcgtattggtgtaaaaaagatggaggaatgtcatctgagccccgtattcttt
ttagggtatgcttctgtccaagtatttgactatatggcttgtatgcagacaggaaagcta
gatatgcgtctttggagcacaaagaaaaaggcaaacccaatgtgtcctatcccaaagaat
tccaataaaaatgatatggggttttctttgatctttcccagttttaataaacccgtggtg
atcccgaacgttgcacctccagattccaaaaggcgtgactgggaacagcaacttcttgat
agtgatctttgccttgttggaaatttgagagaaagcaaaattgaacagttaagacagtta
aagcgaatccttgcaagtgacccactgactgaacttacaacaattgataaggtgcttctc
tggaaacatcgaggagaactcattttgcgcccgagagcacttgcaaagtttcttcttgct
gttaattggcttcggccttatgctgtatatgaggctcatactattttaccacaatgggct
cctcttcaaccgatggatgcgcttgaattactagatatacgatatgcggatatcgttgtt
cgagagcatgctgtaaagtatctgaacggtatgacagattacgaactcaaagggtgtgtt
ttacaattggtacaagttcttaagcatgaaccctatcatgattccgctttatttagattt
ttgttgagaaggtcattacaatcgccgcatatgatcggccattatgttttttggtacctg
gtttcagagatggagaatacatccgtttctgaacgctatggacttctattggaagaattg
atccgtcgcatgccagaaagaaaagtttatttgcgtcaattgtatttagctgatcaattg
tttgaatgtgcgatgcgtgttaaagatgcgccgaaaaaggatcgcattgactgtcttcga
gagcatcttcaaggcttgcgtttgccacgccgctttaccctccccataaacccggcaatg
gagtgtagcggtctcgatattggtaagtgcaaagtaatggattcaaaaaaatttcctctt
tggcttgtatttagaaactatcaagaagaaggtgatcctttttacgtgatttttaaggca
ggggatgatttgcgacaagatttgtttactcttcaacttcttgaattgatggattccctt
tggaagtcttgtgggttatacctccacatcattccttatgggtgcattactactggagag
ggagtcggaatgattgaggttgttcttaacagtgatactgttgcaaacataactcgcaaa
tatggtggtgcacaagctgccttccgtgaggaaccgctcatgaattggctaaggcagttt
aaccgggaaagagacgaagtggaaagatgtctctggaattttatctgcagcgttgccgga
tatactgtagcaacatatgttttgggtatcggtgatcgtcacaatgataatattatgctt
cgccaggacggaaccctttttcatattgattttggtcatttcttgggaaactttaagacg
aaatttggtattaaaagggaaaccgcgccttttatttttacaccaatgtacgtctatatg
ttgggaggacaaagtagtcctatttatttgtattttgtggatctggcatgtcatgccttc
aacgttgtaagacgttttggtggtacgctgatgactcactttatgctaatgctttcgaca
ggcataccagaactacagaagattgaggacattggctggctaagaactgttttgcttatt
gatcgttcaagtgaggaggcaagggaacattatcggcttcaaatagcccttgctacgagc
aactttcgtactctgttcaatgactatattcatattatgacacattag

DBGET integrated database retrieval system