KEGG   Trypanosoma cruzi: 508889.10Help
Entry
508889.10         CDS       T01012                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    508889.10
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     508889.10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 572 aa AA seqDB search
MRIVMSDEKGSAKTAAWAASLLCFLFMILSIGIVAAAQEGSHELAQIVFVSCNKHDRDQN
YWDVIAATVEHGKDAGQLNKPLKRATGSCAANSPVDALVWLGDAVYADNFSAFRGCYPNT
DLELVRSRFTKQRNASEYVAFRQTCVRQRQNLAFREDGEETQFVMGVWDDHDMGKNDGGA
EYADKDATQQFFLDFLGVAKNSPRRKQKGVYVFETVPFRALDSNASVNPAKSAAIKELHS
LYDHAVCFLLLDARYFREPSNATRSGDMLGEVQWKWLEERLRNDVAGQNPVSGRERCALT
IVGSGVQVIMDEKVTESWGAFPLSRNRLFLLLRRYKSERVIFISGDVHLGEIGMDNTQDA
MEALGYPILEATSSGLTHSSAVFWGLPTLMRTLFPSPRRVGVYIERNFGVVRLTADPEAL
IMALKRDGKAQRHQFERYINVSVFIHSIPQKGKAVLQLSLPLDVFTIDGGGGTKGRFNTF
TSAVKRTCEDPSKENTENGDCSTVYYPRSAPLPVFTSLIQFLQRHIWPQHTLLQVVSTVV
STSVLLLLAATAVFCIRLWNTGSKRKKREKIS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcggattgtgatgagcgacgaaaagggaagcgccaaaacagcggcttgggcagcgtcg
ttgctctgcttcctcttcatgattttgtccattgggattgtcgcggcagcacaagagggg
agccacgaactcgcacaaattgtttttgtcagctgcaacaaacacgaccgggatcagaac
tactgggatgtgattgcggccaccgtcgagcacggaaaagacgctgggcagctgaataag
ccactaaagcgtgctacaggcagttgtgcggcgaattcccccgtggatgcactcgtttgg
cttggcgatgcggtgtacgcggacaattttagtgcctttaggggttgctatccgaacacc
gatttggagttggtccgttcaaggtttacaaaacaacgaaacgcctcggaatatgtcgcc
tttcgccagacatgtgtgcgccagcgccaaaacttggctttccgtgaggacggagaagaa
acgcaatttgttatgggtgtctgggacgaccatgacatgggcaagaacgacggtggggca
gaatacgctgacaaggacgccacacaacagttttttttggatttcctaggtgttgcgaag
aacagcccgcgcagaaagcaaaagggtgtatacgtttttgaaaccgttccatttcgggcg
ttggattcaaatgccagcgtcaatcccgcgaaatccgccgcaataaaagagttgcatagc
ttatatgatcatgctgtgtgctttcttcttttggacgcacgctactttcgtgaaccctca
aatgccactcgtagtggtgatatgttgggtgaagtgcagtggaaatggcttgaggagcgt
ctccgcaatgacgtggcggggcagaacccagtcagcggccgggaacgatgtgcactgaca
atcgtggggagcggagtgcaggtgattatggacgagaaggtgaccgaaagctggggtgca
tttccgctctcgcgaaaccgcctttttttgctgctccgccgatataagagcgaacgagtg
atttttattagcggcgatgtgcacctcggtgagattggcatggacaacacacaggacgcc
atggaggcgctcgggtaccccattcttgaggcgacgagctccggactgacgcacagttcc
gccgtattttggggtttgcctactttaatgaggacattatttcccagtccacgccgcgtg
ggtgtttacattgaaagaaattttggtgtcgtgcgtttgacggcagaccccgaggctctt
atcatggccttaaaacgcgacggcaaggcacagaggcaccaatttgagaggtacataaac
gtctccgtctttattcacagcattccgcaaaaaggaaaggccgttctgcagctgtcgttg
ccattagatgtgtttacaatcgatggaggaggcggtacgaagggccgctttaatacgttc
acttctgcggtgaaacggacatgtgaggacccatccaaagaaaatacagaaaatggagat
tgctcaactgtgtattacccacgttctgctccgttacctgtttttacttctttgattcaa
tttctccaacgccacatatggccccagcacacacttctgcaggttgtttcaaccgttgta
agtacatcggtattgctcctgttagcagctacggcagtgttttgtatacgactgtggaat
accggttcaaagaggaaaaaaagggaaaaaattagctga

DBGET integrated database retrieval system