KEGG   Trypanosoma cruzi: 508959.4Help
Entry
508959.4          CDS       T01012                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
tcr  Trypanosoma cruzi
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    508959.4
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 114 aa AA seqDB search
MPPKARPPLPPGDAAKGEKIFKGRAAQCHTGTKGGANGVGPNLYGIYGRRSGTVEGFAYS
KANQDSGVVWTEEVLDVYLENPKKFMPGTKMAFAGLKKPQERADLIAYLATLRD
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaaggccagaccaccacttccaccgggtgacgccgcaaagggtgagaagatc
tttaagggtcgtgcggcgcagtgtcacacaggaacaaaaggaggggcgaatggcgtgggg
ccaaacctctacgggatttatggtcgtcgctccggcacagtggagggcttcgcatacagc
aaggcaaaccaggactcgggtgtggtttggacagaggaggttttggacgtttatcttgaa
aatccaaagaagttcatgcctggaacaaaaatggcttttgccggtcttaaaaaaccacaa
gaacgtgcagacctcatcgcttatcttgcaacattgcgagattag

DBGET integrated database retrieval system