KEGG   Trypanosoma cruzi: 509239.10Help
Entry
509239.10         CDS       T01012                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tcr01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tcr01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 433 aa AA seqDB search
MTSLNKSETQNISAAEEKVPSNLPQWTKGNYEINWVAVAVLALPPTMVFAAILAGIPLLP
KTFAVAAFFYVFNGMIGITLGYHRLFSHRSFVAHPILQWICVFAGAGAFEGSAKWWGRNH
RIHHRYVDTPKDPYDATRGFFFSHMGWMVMKQNYGLLGKVDVSDFKYNIIIQFQHRYFFR
IAMLSGIILPTLICGLGWGDWLGGYFYAGLAKVVFVHHCTFFINSLAHTSFFGAVQNYSD
RNTSHDSMVCALLTFGEGYHNFHHEFAQDYRNGIKWYHFDPTKWTIRLCEWLRMASHLMR
TPNEVIERNVKNLQYKGVRRQMELLEKRLGELELPTTVEYTWEDVAKYVQQGQKLIVIGD
NVIDLEKSVPTGSGYTHSNEKIVWYEAHPGGKKMLDIYVGKDATEAFQGGIYKHSLGAES
LIPHLRVAKLKRK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtttaaacaaaagcgagacgcagaacatctctgccgccgaagaaaaggttcca
agtaatcttccgcaatggacgaaaggcaactatgaaattaactgggtggccgtcgccgtt
ttggctctacctcccacgatggtttttgcggccattttggcgggtattcccctgcttcca
aagacttttgcggtagcagcatttttctatgtgttcaacggcatgattggtattacactt
ggttaccaccgccttttttcgcatcgaagctttgttgcgcacccgatacttcagtggatt
tgcgtatttgctggtgcgggtgcttttgaaggctctgccaagtggtggggccgcaatcat
cgcatccaccatcgctacgtggacacccctaaagatccatacgatgccactcgtgggttt
tttttttcccatatgggctggatggtcatgaagcaaaattatggcctccttgggaaagtt
gacgtgtcggattttaagtacaacatcataattcagtttcagcatcgctacttcttcaga
attgctatgttgtccggtattattctcccaacgctgatttgcggccttggttggggcgat
tggctcggtgggtacttctatgcagggctcgcgaaggtggtgtttgtgcaccattgtacc
tttttcatcaacagcctggcccacacgagcttttttggtgcggtgcagaattactcggac
cgtaacacctctcatgactccatggtctgtgcactcttgacgttcggggaggggtaccac
aactttcaccacgagtttgcgcaagactatcgtaacggcatcaaatggtatcattttgat
ccgaccaagtggaccatccgcctgtgtgaatggctgaggatggcctcgcatctcatgcgc
acacccaacgaagtgattgaaaggaacgtgaagaatctccaatacaagggggttcgcaga
cagatggaacttctcgagaagcgattaggggagcttgagctccccacaactgtggaatat
acgtgggaggatgttgcaaaatatgtgcagcagggccaaaaactgatcgtgattggggac
aacgttattgatctggagaagtccgttccaacgggctccggctacacgcactccaatgaa
aaaattgtttggtatgaagcacacccgggagggaagaagatgttggatatttatgtgggc
aaggacgctacggaggcattccaaggaggaatatacaagcattctttgggtgccgagagc
ctgattcctcacctgcgtgtcgccaaattgaagcgtaagtga

DBGET integrated database retrieval system