KEGG   Trypanosoma cruzi: 509239.10Help
Entry
509239.10         CDS       T01012                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    509239.10
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    509239.10
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     509239.10
Lipid biosynthesis proteins [BR:tcr01004]
 Desaturase
  First
   509239.10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 433 aa AA seqDB search
MTSLNKSETQNISAAEEKVPSNLPQWTKGNYEINWVAVAVLALPPTMVFAAILAGIPLLP
KTFAVAAFFYVFNGMIGITLGYHRLFSHRSFVAHPILQWICVFAGAGAFEGSAKWWGRNH
RIHHRYVDTPKDPYDATRGFFFSHMGWMVMKQNYGLLGKVDVSDFKYNIIIQFQHRYFFR
IAMLSGIILPTLICGLGWGDWLGGYFYAGLAKVVFVHHCTFFINSLAHTSFFGAVQNYSD
RNTSHDSMVCALLTFGEGYHNFHHEFAQDYRNGIKWYHFDPTKWTIRLCEWLRMASHLMR
TPNEVIERNVKNLQYKGVRRQMELLEKRLGELELPTTVEYTWEDVAKYVQQGQKLIVIGD
NVIDLEKSVPTGSGYTHSNEKIVWYEAHPGGKKMLDIYVGKDATEAFQGGIYKHSLGAES
LIPHLRVAKLKRK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtttaaacaaaagcgagacgcagaacatctctgccgccgaagaaaaggttcca
agtaatcttccgcaatggacgaaaggcaactatgaaattaactgggtggccgtcgccgtt
ttggctctacctcccacgatggtttttgcggccattttggcgggtattcccctgcttcca
aagacttttgcggtagcagcatttttctatgtgttcaacggcatgattggtattacactt
ggttaccaccgccttttttcgcatcgaagctttgttgcgcacccgatacttcagtggatt
tgcgtatttgctggtgcgggtgcttttgaaggctctgccaagtggtggggccgcaatcat
cgcatccaccatcgctacgtggacacccctaaagatccatacgatgccactcgtgggttt
tttttttcccatatgggctggatggtcatgaagcaaaattatggcctccttgggaaagtt
gacgtgtcggattttaagtacaacatcataattcagtttcagcatcgctacttcttcaga
attgctatgttgtccggtattattctcccaacgctgatttgcggccttggttggggcgat
tggctcggtgggtacttctatgcagggctcgcgaaggtggtgtttgtgcaccattgtacc
tttttcatcaacagcctggcccacacgagcttttttggtgcggtgcagaattactcggac
cgtaacacctctcatgactccatggtctgtgcactcttgacgttcggggaggggtaccac
aactttcaccacgagtttgcgcaagactatcgtaacggcatcaaatggtatcattttgat
ccgaccaagtggaccatccgcctgtgtgaatggctgaggatggcctcgcatctcatgcgc
acacccaacgaagtgattgaaaggaacgtgaagaatctccaatacaagggggttcgcaga
cagatggaacttctcgagaagcgattaggggagcttgagctccccacaactgtggaatat
acgtgggaggatgttgcaaaatatgtgcagcagggccaaaaactgatcgtgattggggac
aacgttattgatctggagaagtccgttccaacgggctccggctacacgcactccaatgaa
aaaattgtttggtatgaagcacacccgggagggaagaagatgttggatatttatgtgggc
aaggacgctacggaggcattccaaggaggaatatacaagcattctttgggtgccgagagc
ctgattcctcacctgcgtgtcgccaaattgaagcgtaagtga

DBGET integrated database retrieval system