KEGG   Trypanosoma cruzi: 509331.180Help
Entry
509331.180        CDS       T01012                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    509331.180
   00052 Galactose metabolism
    509331.180
Enzymes [BR:tcr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     509331.180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 380 aa AA seqDB search
MTIISSENAKEYSSHVEPFGDGHKITLKSPNLRVSLLTQGATVFSVQYRVPQLAGGDVAD
KDGWVELVLGLDVPEEFAKDKLYIGSTCGRYSGRIENGEFELNGKSFKLLQNDGENTLHG
GPEGFSSRPWKYILLEGEEEIGISFHLISPHLDQGFPGELFVTATYVILKNEPATLKWNL
QAVLAASTPAQSTVINLCNHIYWNLNGVPSRPRRLPEPITNHHMQLHSGYVAEMQELIPT
GSMKSVEGTPHDYKKLRAIREGMEATQAEGRDPPGYDDPVALDKWDSKLHEAGRLFSPKT
GITLQLDTTSPAVVVYTANYLPENASGEAGERFQRHSGICLETQYFPNSPHIPSFPSTVV
SKGEKYDETTVCHFKYTPKS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgactattatttcctctgagaatgcaaaggaatactcaagccacgttgagccatttggt
gatgggcacaagattacactgaagtcaccgaacctacgcgtgtcgttgctgacgcagggt
gccacggttttctctgtgcagtaccgcgtaccgcagctggctggcggggacgttgctgac
aaggatgggtgggtggagctggtacttggacttgacgtaccggaggagttcgcgaaggac
aaattgtacattggcagcacctgcggccgttactctggtcgcattgaaaatggtgagttt
gaattgaacggaaagtcctttaagctgcttcaaaatgacggcgaaaatacgttacatgga
gggccggaggggttttcgtcccggccgtggaagtacatcctgttggaaggggaggaggag
attggcatctcctttcacctcatatcgcctcaccttgatcagggttttcctggggagctg
tttgtcacggccacctacgtcattttgaaaaatgagccggcaacgcttaagtggaatctg
caggcggttttggccgcctccaccccggcgcagtccacggtcatcaacctttgcaaccac
atttattggaatcttaacggtgtaccgtcacggccgcgtcggcttccagagcccatcaca
aaccatcacatgcaacttcactccggctacgtggcagagatgcaggagctcattcctaca
ggctccatgaagtcggtggaaggaacgccgcacgattacaagaagctacgcgcgattcgt
gaaggcatggaggcaacgcaagcggagggtcgagatcctccaggatacgatgatcctgtc
gcgctcgacaagtgggactccaaactgcatgaagcgggccgcctattcagtcccaagaca
ggcatcactctgcaattggatacaacgtcaccggcggttgtcgtgtacactgcgaactat
cttccagagaatgccagcggtgaggcaggcgagcgattccaacggcacagtggcatctgc
ttggagacgcagtacttcccaaactcgccccacatcccctccttccctagcacagtagtg
agtaagggagagaagtacgatgagacaaccgtatgtcactttaagtatactccgaagagt
tga

DBGET integrated database retrieval system