KEGG   Trypanosoma cruzi: 509331.70Help
Entry
509331.70         CDS       T01012                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase (EC:1.3.99.5)
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     509331.70
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 338 aa AA seqDB search
MLKRHGGNLSSTWAWLLVAVVFLLITTVCMVLLQQYVLPLGSTTVIESASYFHLVMAAMT
YFTLRFVEVAPFGRHATSTTAHVTMPAPLSWALQECPTLINVVYYLLMEYPCHALKCSSS
QWIRLVFDDPFGQAAHAISEGITSLHVGLLLFVIHYLHRTFLYPLIIGEGAPVPIKITLS
AAVYCLLNGRLQLLANIRDGPSAPRFPLLFTSHMALFWIGIVLFFAGMGVNVLSDNRLVR
LKKQPPRHSRKIPHGGLFEYVSCANFFGEIVEWCGYSLVVWSTTATTKPESGLAAFSFSV
YVMANLLPRGYAHHEWYKKQFGGAYDTLRRKAVIPYVY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagcgacatggtggcaatctctcgtccacatgggcgtggcttttggtcgcggtg
gtgtttcttctaatcacaacagtatgtatggttctgctccagcaatacgtattgcccttg
ggtagtacaacagtcattgagtcagcaagttattttcatcttgtgatggcagccatgact
tattttacattgcgttttgttgaagtcgctccatttggtcgtcatgcgacgagtacaact
gcacatgttactatgccagcaccactttcatgggcgctgcaggagtgcccgacgctgata
aacgtcgtttattatcttcttatggagtacccgtgtcatgcattgaaatgtagcagcagc
cagtggatacgtcttgtgtttgatgatccgtttggacaggcggctcatgcgatctcagaa
ggaatcacatctctccatgtgggcctcttactttttgtcattcattacctgcaccggact
ttcctgtaccctttgatcataggcgaaggagctccggttccaattaaaataacgttgagt
gctgcagtatattgtctactcaacggtcgtcttcagctgttggcaaatattcgtgacggg
ccttctgcgcctcgtttccctctcttatttacaagtcatatggcgttattttggattgga
atcgttctcttctttgctgggatgggggtgaatgttttgtccgacaaccgtctcgtgcgc
cttaagaagcagccaccgaggcactcgcgtaaaattccacatggaggactttttgaatac
gtgagctgcgccaacttctttggggaaattgtggagtggtgcggctactcccttgttgtg
tggtcaacaacagccacgacaaagccggagtcgggtctggcggctttcagtttttcggtt
tacgttatggcaaacctgctcccgcgcggttacgcgcaccacgagtggtacaagaaacag
tttggtggtgcctacgatacactgcgacgcaaggctgtcataccgtacgtctactag

DBGET integrated database retrieval system