KEGG   Trypanosoma cruzi: 509553.60Help
Entry
509553.60         CDS       T01012                                 

Definition
mitogen-activated protein kinase 3 (EC:2.7.1.-)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tcr  Trypanosoma cruzi
Pathway
Chagas disease (American trypanosomiasis)
Class
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:tcr05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 372 aa AA seqDB search
MHDSNQELCEPTIVGDFKLYNVSGSQFEVPRKYTLLKILGTGAYGIACSCLNEETKEKVS
VKKCRDVFRDLEDGKRVLREIAMMRFFQHENLLHIMDILPPMKSYTEFRDVYIVTPLKDV
DMNVVLRSRQELTGAHVRYFVYQILRGLKYLHSAGVAHRDLKPANLVTDITCELKIIDFG
LSRNVTMPYYELTDYVITRWYRPPELLLENNYYTTAVDIWSVGCIMAEMYTRKPVLRGRN
TLDQLRLICTHIGKPPSEMVNNPEALDKLHGLPDGSLEVTELVPGLTDPEAIDILTKMWE
LDPAKRQSAAELLQHPFLAALHDEQDEPECPTLFSWPYEQKEMNDSLLRRAFWEEICAFN
PQLKSQMPPASP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatagcaaccaggagctttgtgagcccacgattgtgggtgatttcaagctttat
aatgtgagtggttctcagtttgaggtgccgaggaagtacacactgttgaagatacttggg
acaggtgcgtacggcattgcctgcagttgcctcaatgaggagacaaaggaaaaggtttcc
gttaagaaatgtcgtgacgtctttcgggatttggaggacggcaaacgtgtgctgcgcgag
attgcgatgatgcgctttttccaacatgagaatttgctgcacatcatggacattttgccg
cccatgaaaagctacactgagtttcgggatgtgtacattgtcacgcccttgaaggacgtg
gatatgaacgttgtgttgcgttccaggcaagagctgacaggtgcacatgtgcggtatttt
gtgtaccagatcctacgtgggttgaagtatctacatagcgccggcgttgcccaccgcgac
ctcaagccagccaaccttgtcacggatattacatgtgaactgaaaattattgattttggt
ctttcgcggaatgtcacaatgccgtactatgagctgacggattatgtcatcacacgctgg
taccgcccaccggagctgctgcttgaaaacaattattacacaacagcggtggatatttgg
tctgttggatgtatcatggcggagatgtacacgcgcaagccggtgcttcgtggtcgtaac
acgctggaccagctacgtctgatttgtactcacattgggaaaccaccgagtgagatggtc
aacaaccctgaagcgctggacaaactgcatggccttccagacggatcgctggaggtgact
gaactggtgccgggtttgacggacccggaggcaattgacatcctcacaaagatgtgggag
cttgacccagccaagcgtcagtcagcggcggagctgcttcagcatccctttttggcggcc
ctgcacgatgaacaggatgaacccgagtgcccaacactcttttcatggccgtatgaacaa
aaggaaatgaatgatagtcttttgcgacgggctttctgggaggaaatttgtgcttttaac
ccccaattgaagtcgcaaatgccccctgcttctccttag

DBGET integrated database retrieval system