KEGG   Trypanosoma cruzi: 509647.70Help
Entry
509647.70         CDS       T01012                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tcr  Trypanosoma cruzi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tcr00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 206 aa AA seqDB search
MNPPLDAIAVCGPSGVGKGALLGRLLRDFPDRFGYSVSHTTRAPREGEENGREYHFSDRA
TVEKMRDEDGFIEVCEVHGNLYGTSVRAVAEVRSTGKVCILEVDIKGAQKIREKTGLLNA
LYIFVTPPSMEDLRERIRKRGAENEEVLQHRLRTAEEELRFVEENPTFFSHIILNKDLDA
AYEELLRVLNEAFLRCNMSKLELNSE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccccactggacgcgattgccgtttgtggcccatcaggcgtagggaagggggcg
cttcttggtcgcctgcttagggattttccggatcgttttggctactccgtctcgcacacg
acaagggctccgcgcgaaggtgaagaaaatggacgcgaataccacttttctgatcgagcc
acagtagaaaaaatgcgggacgaagacgggtttattgaagtgtgtgaggttcacgggaat
ttgtatggcaccagcgtgagagctgtggctgaagtgcggagtactggaaaagtctgcatc
cttgaggtggatatcaaaggagcccaaaagatacgcgagaagacggggttgctgaatgca
ttatacatttttgtgacgcccccctcgatggaagatctgcgcgaacgcattcggaagcga
ggggcggaaaacgaagaggttctccaacatcgactccgtactgccgaagaggagctgcgg
tttgttgaggaaaaccctacctttttttctcatattattcttaacaaggaccttgacgca
gcgtacgaggagctgctgcgtgttcttaacgaggcatttttgaggtgtaacatgtccaaa
ctggagctgaattccgagtaa

DBGET integrated database retrieval system