KEGG   Trypanosoma cruzi: 509769.110Help
Entry
509769.110        CDS       T01012                                 

Definition
acetyltransferase (EC:2.3.1.48)
Orthology
K00653  
histone acetyltransferase [EC:2.3.1.48]
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 669 aa AA seqDB search
MAERPMTSKRPREEECGMEGGVEKTSWRGEQPPKAVQQSNLHRSLKEARFAGRSMEEGFH
RQLGPYEAPDEAVDVEDLVQGHEDFGDLPEGRRRALLESVRVLAQKVAATKSKNQLEHLR
VKASCLVGFKDTARKSELTAAYRQLVRAGELQASPVMEELLVRKRGKSHSGVLVVTVFMG
PGQFSCPKDCHYCPNQPGIARSYLLKEPGVLRGYRNGWDPISQFYDRASALENNGHVVDK
IELIILGGTFSFYPKKYAEEFIAGSFYAANTYYDSAPLRPMQSLQEEITFNEDARCRVIG
VTVETRPDYINASELRRFRCLGVTRVQLGVQHLDDDILTIVNRECPTAKTILGIKRLLDA
GFKVDAHWMPDLPGSSYKKDREMFEYLFSLDNENFQVDQWKVYPTATVPYTKIEEWHRKG
LYKPYAEVDDGAWMVKLLVYIMEQCPYRIRLNRIVRDIPTTYIMGGERRCNLRQVIEAEM
KAKGIRCKDIRERECKGKPVDRDHTKIFVDEFRASDGTEFYISVEDPERTTLYGHLRLRL
RDNSGAENSIFKALEGCALIRELHTYGRLVAVSRPNSGNAAQHVGVGTQLMREAERISLS
RGFSRLAVIAGVGVRRYYGKLGYHLEETYMVKGLAVNGENAITEEQVVQDDDNDNLGFFS
KLKSLIFRK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaggccgatgacatccaagcgtcctcgggaagaggagtgcgggatggaggga
ggtgtcgaaaagacatcgtggcggggcgaacagccaccaaaagcggtacaacaatccaac
ttgcatcgatcgctgaaggaggcacgttttgcggggcgatcgatggaggagggattccat
cggcagttgggaccctacgaggcacccgatgaggcggtggatgtggaggatttggttcag
ggacacgaggactttggcgatctgcccgaggggcgccgtcgcgcgctgttggagtcggtg
cgggtgctggcgcagaaggttgctgcgacaaagagcaagaaccaactggaacacctgcgc
gtgaaggcgtcctgccttgtgggcttcaaggacactgcgaggaagtccgaactgacggcg
gcgtaccgtcaattagtacgggcaggtgagctgcaggcgtcaccggtgatggaggagctt
ctggtgcgtaagcgcggtaagtcgcatagcggcgttcttgtagtgactgttttcatggga
ccgggtcaattttcttgtccgaaggattgccattactgcccgaaccagccaggtatcgca
cgatcgtatctactcaaggaaccaggcgtattgcgcgggtaccgcaatggatgggaccct
atctcccagttttatgatcgggcgagcgcgctggaaaacaacgggcatgtggtggacaag
attgagcttattattcttggtgggacgttttcgttttacccgaagaagtacgccgaagaa
tttattgccggttctttttacgctgccaacacatattacgactctgcgccactgcggccc
atgcagagtctgcaagaggaaattacatttaacgaagatgcccgctgtcgtgtcattggt
gtaacggtggaaacacgtccagattacatcaacgcatctgaattgcgtcgattccgttgc
cttggtgttactcgtgtgcagcttggcgtgcagcatcttgacgacgacatcctcacaatt
gtgaatcgtgaatgcccgacagccaaaaccattttagggattaaacgattgctcgacgcg
gggtttaaagtcgatgctcactggatgcccgatttgccaggaagtagttataaaaaggat
cgtgaaatgtttgagtatctgttctctcttgacaatgaaaacttccaggtggatcaatgg
aaggtctatcccacagcaacggtaccctatacaaagattgaggagtggcatcgtaaaggg
ctttacaagccctatgcggaggtggatgacggtgcctggatggtgaaacttcttgtgtac
atcatggaacagtgcccttatcgcattcgtttaaatcgtattgttcgtgacattccaacg
acttacatcatgggtggcgagcggcggtgtaacctgcggcaggttattgaggcggagatg
aaagcaaaggggattcgttgcaaggacattcgtgagcgtgaatgtaagggcaagcccgtc
gatcgcgatcacacaaaaatttttgtggatgaatttcgcgcaagcgacgggacggagttt
tatatctccgtcgaggaccctgagagaacgacactttacgggcatttgcggttgcggttg
cgtgacaacagtggggccgagaattccatctttaaggcgcttgaaggttgtgcgctaatt
cgcgagttgcacacctacggccggcttgtggcggtgtcgcggcccaattctggaaatgcg
gcacaacacgtgggcgtgggcacacaactgatgcgtgaggctgagcgaatctccctgtcg
cgcggatttagccggttggctgtgattgcaggggtcggtgtacggcggtactacggcaag
ctcgggtatcacctggaggagacatatatggtcaagggtcttgcagtgaatggggagaac
gccattacggaggagcaggtggtgcaggatgacgacaatgacaatcttggtttcttttcc
aaattgaagagtctcattttcaggaagtga

DBGET integrated database retrieval system