KEGG   Trypanosoma cruzi: 509803.30Help
Entry
509803.30         CDS       T01012                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tcr  Trypanosoma cruzi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    509803.30
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     509803.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 572 aa AA seqDB search
MQIVMSDEKKSATTAAWAAPLLCFLFMILSIGTVAAAQEGSHELAQIVFVSCNQHDRDQN
YWDVIAATVEHGKDAGQLNKPLKRATGSCAANSSVDALVWLGDAVYADNFSAFRGCYPNT
DLELVRSKFTKQRNAPEYVAFRQTCVRQRPTLAFREDGEETQFVMGVWDDHDMGKNDGGA
EYADKDATQQFFLDFLGVAKNSPRRKQKGVYVFETIPFRALDSNASVNPAKSAAIKELHS
LYDHAVCFLLLDARYFREPSNATRSGDMLGEVQWKWLEERLRNDVAGQNPVSGRERCALT
IVGSGVQVIMDEKVSESWGAFPLSRNRLFLLLRRYKSERVIFISGDVHLGEIGMDTTQDA
MEALGYPILEATSSGLTHSSATFWGLPTLMRTLFPSPRRVGIYIERNFGVVRLTADPEAL
IMALKRDGKAQRHQFERYINVSVFIHSIPQQGKAVLQLSLPLDVFTIDGGGGTKGRFTTL
TSAVKRTCENPSKENTENGDCSPAYYPRSAPLPVFTSLIQFLQRHIWPQHTLLQVVSTVV
STSVLLLLAATAVFCIRLWNTGSKGKKREKIS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgtgatgagcgacgaaaagaaaagcgccacaacagcggcttgggcagcgccg
ttgctctgcttcctcttcatgattttgtccattgggactgtcgcggcagcacaagagggg
agccacgaactcgcacaaattgtttttgtcagctgcaaccaacacgaccgggatcagaac
tactgggacgtgattgcggccaccgtcgagcacggaaaagacgctgggcagctgaataag
ccactgaagcgtgctacaggcagttgtgcggcgaattcctccgtggatgcactcgtttgg
cttggcgatgcggtgtacgcggacaattttagtgcctttaggggttgctatccgaacacc
gatttggagttggtccgttcaaagtttacaaaacaacgaaacgccccggaatatgtcgcc
tttcgccagacatgtgtgcgccagcgcccaaccttggctttccgtgaggacggagaagaa
acgcaatttgtcatgggtgtctgggacgaccatgacatgggcaagaacgacggtggggca
gaatacgctgacaaggacgccacgcagcagttttttttggatttcctaggtgttgcgaag
aacagcccgcgcagaaagcaaaagggtgtatacgtttttgaaaccattccatttcgggcg
ttggattcaaatgccagcgtcaatcccgcgaaatccgccgcaataaaagagttgcatagc
ttatatgatcatgctgtgtgctttcttcttttggacgcacgctactttcgtgaaccctca
aatgccactcgtagtggtgatatgttgggtgaagtgcagtggaaatggcttgaggagcgt
ctccgcaatgacgtggcggggcagaacccagtcagcggccgggaacgatgtgcactgaca
atcgtggggagcggagtgcaggtgattatggacgagaaggtgagcgaaagctggggtgca
tttccgctctcgcgaaaccgcctttttttgctgctccgccgatataagagcgaacgagtg
atttttattagcggcgatgtgcacctcggtgagattggcatggacaccacacaggacgcc
atggaggcgctcgggtaccccattcttgaggcgacgagctccggactgacgcacagttcc
gctacattttggggtttgcctactttaatgaggacattatttcccagtccacgccgcgtg
ggtatttacattgaaagaaatttcggtgtcgtgcgtttgacggcagaccccgaggctctt
atcatggccttaaaacgcgacggcaaggcacagaggcaccaatttgagaggtacataaac
gtctccgtctttattcacagcattccgcaacaaggaaaggccgttctgcagctgtcgttg
ccattagatgtgtttacaatcgatggaggaggcggtacgaagggccgcttcactacgttg
acttctgcggtgaaacggacatgtgagaacccatccaaagaaaatacagaaaatggagat
tgctcacctgcgtattacccacgttctgctccgttacctgtttttacttctttgattcaa
tttctccaacgccacatatggccccagcacacacttttgcaggttgtttccaccgttgta
agtacatcggtattgctcctgttagcagctacggccgtgttttgtatacgactgtggaat
accggctcaaaggggaaaaaaagagaaaaaattagctga

DBGET integrated database retrieval system