KEGG   Trypanosoma cruzi: 509955.10Help
Entry
509955.10         CDS       T01012                                 

Definition
ubiquitin hydrolase (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     509955.10
Peptidases [BR:tcr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   509955.10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 173 aa AA seqDB search
FVHLVRFSWRADTQKKAKILKPVSFPLVLDTFTLCTDALKESMQEERGRVLARRDKELER
RRQARQKTQFDVTTNAEEVSTGAMAGDAHKIGNKSGYYELCGVISHKGRSAESGHYVFWG
KPEDQWFVYDDEHVASVTEEDVKRLSGVGEAHIAYVLMYRSRDPRTKATTIPL
NT seq 523 nt NT seq  +upstreamnt  +downstreamnt
ttttgtgcatcttgtgcgtttttcatggagggcagatactcaaaagaaggccaaaatact
caagccagtctccttccccctggtactagatacctttactctctgtacggatgcactaaa
ggaaagcatgcaggaggaacgaggcagggtgttggctcggcgagacaaggagcttgagcg
acgtcgtcaagcccggcaaaagacacaatttgacgttaccacaaacgcagaagaggtgtc
aactggggcgatggcaggtgacgcacataaaattggcaataagagtggttactatgaact
ttgtggtgtaatttcccacaagggccgaagtgcagagagtgggcactacgtcttctgggg
taagcctgaggatcagtggtttgtctacgatgatgagcacgtggcctctgtgacagagga
agacgtcaagcgtctgagtggcgttggtgaggcgcacattgcgtatgttcttatgtaccg
ttctagggacccacgtacaaaggccacgacgattccactttga

DBGET integrated database retrieval system