KEGG   Trypanosoma cruzi: 509965.40Help
Entry
509965.40         CDS       T01012                                 

Definition
ubiquitin hydrolase (EC:3.1.2.15)
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 755 aa AA seqDB search
MLCSCTERVDPQRLRVKFANAWLKEGVLTSEPLTMYCTLCEQRGLMSGKTKSKTKLHGFS
IFRKTRDEADGSGENALDDLFLCFTCTMCFCAAHAKIHEEEQRRAAMAGNSNRGKRHFLF
FAVPFWAKTVGTYTPSGKNKTLFPTFHVDDLEHIRESGPLTLEKEAAIVFRPSGDSHGWV
YNVWCTHCSEKPAPLRFSEFQESDPLHVHIKLLGDIIARLRFLFYEGIRIELPAEWSALN
QGNFHTGESSSYPRACGDIYANRNTLHDLDVHASGTSSMGTSSFALRGSKGDGEALVLAH
VAGIENHRNTCYFNSVLQCVLKCRFFTRPLLSLDVGALPGPLSYRIYAMARHLSEQTLAD
VQTRAVYPFARAVLRCLCELAPLFAEDDQQDSQELFLCMINGVADEFDKGKSEEEKKKGP
RLSFEGVMRTEVVCTQCESRFPREELFMALSVPVEDSIESGLRKLFRPMHLREKDQYACE
RCFKGLTKAEQERHNAAIRAENERKEKAKKKASAEEKRSLNCVYSDAVVSTSISRLGGTL
ALHLLRFQSDGRDFQKVTRSVAFPMSLDLAPFVSKDVLREYEMARGLSALQARFPHVQRD
RLLRFFEHASGDLQKAERMLIGMEEKGALNGEDDALLEFKAGQGASDGSMPGITTCRSSG
HTSCDVSPAGFSPVSSVMKTNDVVGEGQEPLPALKRELVGIVAHRGSLHGGHYIAYVRDD
SRPNSWFRCDDEDVERVDKEYVLRCQSEVYMLFYE
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgctctgctcctgcaccgaacgggtagacccgcagcgtttgcgggtgaagtttgcaaat
gcatggctaaaggagggagttttgacctcagaacccttgacaatgtactgcaccttgtgt
gagcagcgggggcttatgtctggcaagacgaagagcaaaacaaaactgcacggctttagc
attttccgaaaaacgagggatgaggcagatggctcaggggagaatgcattggatgatctc
ttcttgtgtttcacatgtaccatgtgcttttgtgcggcacatgcaaagatccatgaagaa
gaacagagaagagctgccatggctggcaacagcaatcgtggaaaacgtcactttttattt
tttgctgttccattttgggcaaagacggtgggaacttataccccgtcagggaaaaacaaa
actctgtttcccacttttcacgtagatgacctcgagcatatacgtgagtcgggccccctg
acgcttgaaaaggaggctgccattgtcttccgtccaagcggtgattcacatgggtgggtt
tataatgtatggtgtacgcattgcagcgagaagccggctccacttcgcttctccgagttt
caggagtccgacccacttcatgtacacatcaagctgttaggtgatattattgcaaggctt
cgttttcttttctatgagggaattcgaatagaactacccgccgaatggtctgcattaaac
cagggcaatttccacacaggggagtcctcgtcctatccacgtgcttgcggggacatttat
gctaaccgtaatactttgcatgatttggatgttcacgcgagtggcacttcttctatgggc
acatcctcttttgcattgcgagggtcaaaaggggacggtgaggctcttgtgttagcacat
gttgctggtattgagaatcatcggaacacttgctactttaactctgtcttgcaatgtgtt
cttaaatgtagattttttacacgtccactgctttctctagatgttggagctcttccgggt
ccgctgagttatcgcatatatgccatggctcgtcatcttagtgaacagacccttgcggac
gtgcagacacgtgcagtttatccatttgcacgtgcggtattacgttgtctatgtgaactt
gcccctctctttgcggaggatgatcagcaggattcccaggaactctttttgtgtatgatt
aatggtgtggccgatgagtttgacaagggcaagtccgaggaggagaagaaaaaaggccca
cgattatcttttgagggggttatgcgcacggaggttgtctgcacgcagtgtgaaagtcgt
tttccacgtgaggagttattcatggccctctcggttcctgttgaagactcgattgagagt
gggctgcgcaaactctttcggccgatgcatcttcgggaaaaggatcaatatgcatgtgaa
aggtgttttaaagggcttacgaaggcggaacaggagcgacacaacgcggctatcagggcg
gagaatgaaagaaaagagaaggccaagaaaaaggcatcggccgaagagaagcggagtctt
aactgtgtatattctgacgccgttgtatcgacatccatcagtcggttgggcggtacattg
gctctgcacctgctgcgattccaatcggacggccgcgacttccaaaaggttacccggagc
gtggcgttccccatgtcgcttgacctggcaccgtttgtatcaaaggatgtgttaagggaa
tacgaaatggcacgtggcctctctgctctccaggcacgatttccacacgtacaacgtgat
cgtttgcttcgcttctttgaacacgctagcggtgaccttcagaaggcggaacggatgctg
atcgggatggaagaaaagggtgcgttgaacggcgaggatgatgccctgctggagttcaaa
gcgggacaaggggcgtcggatggctcaatgccagggatcaccacgtgtcgttcaagcgga
cacacgagctgcgatgtgagccccgctggcttctctccagtgtcttctgtgatgaaaaca
aatgatgtagtgggggaagggcaggaaccactcccggcgcttaagcgggagcttgtcggc
atcgttgcacaccgcggttctcttcacggcggccactacattgcatacgtgcgagatgac
agccgcccgaatagctggtttcgctgcgatgacgaggatgtggaaagggtagacaaggaa
tatgttctgcgttgccaatcagaggtatacatgttgttctacgagtag

DBGET integrated database retrieval system