KEGG   Trypanosoma cruzi: 510123.20Help
Entry
510123.20         CDS       T01012                                 

Definition
mitogen activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tcr  Trypanosoma cruzi
Pathway
Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Human Diseases
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    510123.20
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     510123.20
Protein kinases [BR:tcr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   510123.20
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   510123.20
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 417 aa AA seqDB search
MSHQIRSLSELQEEVNSLDSRYVLEKIIGAGSYGIVIRARDTLNDNELVALKRVNKEIFE
EMILAKRVLREIKLLSFFNDENIIALRNILTPLDSEDFDHFYIVMEIMETDLKQVLRTGQ
ELTEAHVQFFIYQILHALKVIHTAGVIHRDITPANILVNQNCDLKICDFGLAKEENDRGE
NMTDYVTMRWYRAPELVMEDKNYSAQIDVWGVGSILGELLGSRPLFQGKDRVRQLDKIIE
VIGTPSEEDIKSLGSLPAQKYLRKKETRPPLDWRAKYPKASEEALDLLKRMLVFHPDKRI
TVDEALRHPFLAELYDEQYETINIPLFSFDEQEQKTVHDVKKAVYEESVMFHEKYPKTAP
RHRQLQHQQQQQQQQQGGSALPSMDVTGEGRSAQRTIERDNVEDVDNGRFDEMLEAS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcaaatccggagtttgtccgaactgcaggaggaggtaaactcattggatagt
cgctacgtattggagaaaattattggtgccggttcgtatggaatagtaatacgtgccagg
gacacactcaatgacaacgaacttgtagccctcaagcgtgtaaacaaggaaatatttgag
gagatgattttggcgaagcgtgtgttgcgtgagattaagttactttcattttttaacgat
gagaatattattgctcttcgaaacattctcacaccgcttgacagtgaagattttgatcac
ttctatattgtcatggagatcatggagacagatctgaagcaagtgctacgcactggccaa
gagctgacggaggctcatgttcagttcttcatttatcaaatcctccatgcattgaaggtg
attcataccgctggggttattcaccgcgacatcaccccagcgaacattctagtgaaccag
aattgtgatttgaaaatatgtgactttggtctcgcaaaggaggaaaatgaccgtggagag
aacatgactgactacgtgacaatgcgctggtaccgagcaccggagcttgtgatggaggac
aagaactactccgcacaaattgacgtctggggcgtagggagtattcttggcgagctgctt
ggttcacgaccgctattccaaggcaaggaccgtgtgcgacaactcgacaagatcattgag
gtgattggcactccgtccgaggaggatataaaatccctcggctcactgccggcacagaag
tacctccgcaagaaggagactcgtcccccactagactggcgcgcgaagtacccgaaggcg
tctgaggaggcgctcgatctgctgaagcgcatgctcgtctttcaccccgataaacgcatc
accgtggatgaggctcttcggcacccgttcctggcggaactctacgacgagcaatacgaa
accatcaacataccccttttcagcttcgacgaacaggaacaaaaaacggtgcatgacgtg
aagaaggcggtgtacgaggaaagtgtgatgttccatgaaaagtaccccaagaccgcaccg
cgtcatcggcagttacagcaccagcaacaacaacagcagcagcagcagggtggctcagcc
cttccgtctatggatgtcaccggcgaggggcgctcggctcaaaggacgattgaacgagac
aacgtggaggatgtagacaatggccggtttgacgagatgttggaggcgtcttag

DBGET integrated database retrieval system