KEGG   Trypanosoma cruzi: 510167.10Help
Entry
510167.10         CDS       T01012                                 

Definition
phosphatidylinositol 3-kinase 2
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tcr  Trypanosoma cruzi
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    510167.10
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    510167.10
 Human Diseases
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    510167.10
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     510167.10
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 1055 aa AA seqDB search
MSSPSELFEGLKVDFREELEAEDIYGSENSEGFERLFERSEKCKRNVTQLSTILQSLIFQ
ENEIETEGELEAIIEYIVGTGLYGQSSSLEAKEFRKKIRASFEYEWHEFQKENSSISSSR
AMRTLPYRFSLPSLEKAQLEMLTELSSRGMSNGSLGTVLLRIWYIDLVGCTCSTLRGFPF
DMKASDAILITMERLFLITNFDKSKSQGIMYVFKIQGRKEYVYGDEILINFCYIRDSVTQ
QREVNVVVEPHEKTLLTDPIFVPSYSYFSKTSDEHHHVYYKSESPDDISTGISVWDIEGK
LVVKIGENLCNLVFTSERAKEEGVREGDLLYLAMLVEVYHGAKLVCRPQMTKWTVCNDLV
ASNELNTSSSVNWGKETKLTFDILVSNAPREIKLCISLLATCGERFCSVNSLSAEEIVQK
AEERIGVKKMEECHLSPVFFLGYASVQVFDYMACMQTGKIDMRLWSTKKKANPMCPIPKN
SNKNDMGFSLIFPSFNKPVVIPNVAPPDSKRRDWEQQLLDSDLCLVGNLRESKIEQLRQL
KRILASDPLTELTTIDKVLLWKHRGELILRPRALAKFLLAVNWLRPYAVYEAHTILPQWA
PLQPMDALELLDIRYVDIVVREHAVKYLNGMTDYELKGCVLQLVQVLKHEPYHDSALFRF
LLRRSLQSPHMIGHYVFWYLVSEMENTSVSERYGLLLEELIRRMPERKVYLRQLYLADQL
FECAMRVKDAPKKDRIDCLREHLQGLRLPRRFTLPINPAMECSGLDIGKCKVMDSKKFPL
WLVFRNYQEEGDPFYVIFKAGDDLRQDLFTLQLLELMDSLWKSCGLYLHIIPYGCITTGE
GVGMIEVVLNSDTVANITRKYGGAQAAFREEPLMNWLRQFNRERDEVERCLWNFICSVAG
YTVATYVLGIGDRHNDNIMLRQDGTLFHIDFGHFLGNFKTKFGIKRETAPFIFTPMYVYM
LGGQSSPIYLYFVDLACHAFNVVRRFGGTLMTLFMLMLSTGIPELQKIEDIGWLRTVLLI
DRSSEEAREHYRLQIALATSNFRTLFNDYIHIMTH
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccccagcgaattgtttgaaggtttgaaagtcgattttagggaagagctggag
gcggaagatatttatggttccgaaaactctgaagggtttgagcgactctttgagaggagc
gaaaaatgtaaacggaatgtaacacagctttctactattctccaatctcttatctttcag
gagaacgaaattgagactgaaggtgaacttgaggctattatagaatacattgtgggcact
ggtttatatggccagagtagcagtcttgaggccaaggagttcagaaagaagattcgcgcc
tcgtttgagtatgaatggcatgagtttcaaaaggagaactcttccatctcctcttctcgg
gctatgcgtactttgccatatcgcttttccctgccttctctcgaaaaagcacagcttgaa
atgctgaccgagttgagttcaagagggatgagtaacgggagcttgggtacggttttgctt
cgtatctggtacatagatcttgttggttgtacctgctccacattgcggggatttccgttt
gacatgaaggcttcagatgcaatactgatcacaatggaacgcttgtttttgattacaaat
tttgacaaaagtaaaagccaaggaatcatgtacgttttcaaaatacagggacgaaaggaa
tacgtttatggggatgaaatattgattaatttttgctacataagggacagtgtgacacag
cagcgggaggtaaatgtggttgttgagccgcatgagaagacacttctaactgaccctata
tttgtgccttcgtactcgtacttcagcaaaaccagtgatgaacatcaccatgtttattat
aaaagtgaatctcccgatgacatctccacaggaatcagtgtttgggatattgaaggtaaa
ttggtagtcaaaattggagagaatctctgtaatcttgtctttacttcggagagagcaaag
gaagaaggtgttcgcgaaggcgatttattgtatcttgcaatgcttgtagaagtttaccat
ggtgccaaattggtttgtcgacctcagatgactaagtggacagtgtgtaatgatttggtt
gcgtcgaatgagcttaatacttcttcctccgttaattggggaaaggaaacgaaactgacg
tttgatatactagtttctaatgcccctcgagaaatcaaattgtgtattagtctgttggcc
acctgtggggaacgcttttgtagtgtgaattctctcagcgctgaagaaattgttcaaaaa
gcagaggagcgtattggtgtaaaaaagatggaggaatgtcatctgagtcccgtattcttt
ttagggtatgcgtctgtccaagtatttgactatatggcttgtatgcagacaggaaagata
gatatgcgtctttggagcacaaagaaaaaggcaaacccaatgtgtcctatcccaaagaat
tccaataaaaatgatatgggtttttctttgatctttcctagttttaataaacccgtggtg
atcccgaacgttgcacctccagattccaaaaggcgtgactgggaacagcaacttcttgat
agtgatctttgccttgttggaaatttgagagaaagcaaaattgaacagttaagacagtta
aagcgaatccttgcaagtgacccactgactgaacttacaacaattgataaggtgcttctc
tggaaacatcgaggagaactcattttgcgtccgagggcacttgcaaagtttcttcttgct
gttaattggcttcggccttatgctgtatatgaggctcatactattttaccacaatgggct
cctcttcaaccgatggatgcgcttgaattactagatataagatatgtggatatcgttgtt
cgagagcatgctgtaaagtatctgaacggtatgacagattacgaactcaaagggtgtgtt
ttacaattggtacaagttcttaagcatgaaccctatcatgattccgctttatttagattt
ttgttgagaaggtcattacaatcgccgcatatgatcggccattatgttttttggtacctg
gtttcagagatggagaatacatccgtttctgaacgctatggacttctattggaagaattg
atccgtcgcatgccagaaagaaaagtttatttgcgtcaattgtatttagctgatcaattg
tttgaatgtgcgatgcgtgttaaagatgcgccgaaaaaggatcgcattgactgtcttcga
gagcatcttcaaggcttgcgtttgccacgccgctttaccctccccataaacccggcaatg
gagtgtagcggtctcgatattggtaagtgcaaagtaatggattcaaaaaaatttcctctt
tggcttgtatttagaaactatcaagaagaaggtgatcctttttacgtgatttttaaggca
ggggatgatttgcgacaagatttgtttactcttcaacttcttgaattgatggattccctt
tggaagtcttgtgggttatacctccacatcattccttatgggtgcattactactggagag
ggagtcggaatgattgaggttgttcttaacagtgatactgttgcaaacataactcgcaaa
tatggtggtgcacaagctgccttccgtgaggaaccgctcatgaattggctaaggcagttt
aaccgggaaagagacgaagtggaaagatgtctctggaattttatttgcagtgttgccgga
tatactgtagcaacatatgttttgggtatcggtgatcgtcacaatgataatattatgctt
cgccaggacggaaccctttttcatattgattttggtcatttcttgggaaactttaagacg
aaattcggtattaaaagggaaactgcgccttttatttttacaccaatgtacgtctatatg
ttgggaggacaaagtagtcctatttatttgtattttgtggatctggcatgtcatgccttt
aacgttgtaagacgttttggtggtacgctgatgactctctttatgctaatgctttcgaca
ggcataccagaactacagaagattgaggacattggctggctaagaactgttttgcttatt
gatcgttcaagtgaggaggcaagggaacattatcggcttcaaatagcccttgctacgagc
aactttcgtactctgttcaatgactatattcatattatgacacattag

DBGET integrated database retrieval system