KEGG   Trypanosoma cruzi: 510187.100Help
Entry
510187.100        CDS       T01012                                 

Definition
glucokinase 1 (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    510187.100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    510187.100
   00052 Galactose metabolism
    510187.100
   00500 Starch and sucrose metabolism
    510187.100
   00520 Amino sugar and nucleotide sugar metabolism
    510187.100
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    510187.100
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     510187.100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 376 aa AA seqDB search
MNIKELSLHELCEELKTPAWNVPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRK
DITELIEFFNEIIELMPASVIKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKAL
FPPGRSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLV
LAPGTGLGSSLIYYNPMNQQHIVVPLELGSQTIPMRKDIDYIQTLHAELKLLPNYENMVS
GAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPL
TIVLVGDNIVNNAFFYRNPQNLKEMHREALNHEMERFGFQSRVTYLRQKKLLNLNLMGCY
RCGLDLSVGKKQKAQL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaaggaactcagccttcatgaactgtgcgaggagctcaagactccagcgtgg
aatgtgccgcttaccttcgttggtgatgttggcggaacgagcgcccgcatgggttttgtg
cgtgaaggaaagaacgattctgttcatgcttgcgtcacgcggtactccatgaagcgcaag
gacatcacagagcttattgaattttttaatgagatcattgaattgatgcctgcatcggta
ataaaacgggtgaaggcgggcgtcatcaatgtacccgggcctgtcacgggcggtgctgtg
ggtggaccgttcaacaatctgaagggaattgcgcgtctttcagattacccgaaggcactt
ttcccgccgggccgcagtgccattcttaatgaccttgaagcagggggctttggtgtgttg
gccgtcagtgatgcacatgttttttcggagtacttcggagtcatgtgggaaggcacacag
tggcgcacgtgtgagcaggagccggcagggtccgttattggccgtggtcgctgcctcgtc
ttggctcctggtacggggcttggttcctccctcatctactacaatcccatgaaccagcag
cacatcgtcgttccactggagcttggctcgcagactatcccgatgcggaaggatattgac
tacatccagaccctccacgcagagctgaagcttcttcccaactacgagaacatggtaagt
ggggcagggctggagttccactacaggcaggtggtgcgtgggagcaggccgccgtgctcg
gccggagagattgcgaagctcgcaagtgagggcgacgcgaacgcctgcaaggcaatgaag
aagtaccacgagtacctcatgcgcgttggcagtgaggcgagcatggcccttttgcctctc
actattgtccttgtcggagacaacatcgtgaataacgcgttcttctatagaaacccacag
aacttgaaggagatgcatcgcgaagcactcaaccatgagatggagcgcttcggtttccag
agtcgtgtgacgtacctgcggcagaagaagttactcaacctgaacctgatgggctgctac
cggtgcggtttggacctctccgtggggaaaaagcagaaggcgcaactttag

DBGET integrated database retrieval system