KEGG   Trypanosoma cruzi: 510187.100Help
Entry
510187.100        CDS       T01012                                 

Definition
(RefSeq) glucokinase 1
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00010  Glycolysis / Gluconeogenesis
tcr00052  Galactose metabolism
tcr00500  Starch and sucrose metabolism
tcr00520  Amino sugar and nucleotide sugar metabolism
tcr00524  Neomycin, kanamycin and gentamicin biosynthesis
tcr01100  Metabolic pathways
tcr01110  Biosynthesis of secondary metabolites
tcr01130  Biosynthesis of antibiotics
tcr01200  Carbon metabolism
Module
tcr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tcr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    510187.100
   00052 Galactose metabolism
    510187.100
   00500 Starch and sucrose metabolism
    510187.100
   00520 Amino sugar and nucleotide sugar metabolism
    510187.100
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    510187.100
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     510187.100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-GeneID: 3554379
NCBI-ProteinID: XP_821474
GeneDB: Tc00.1047053510187.100
UniProt: Q4E4E1
Structure
PDB: 

Jmol
AA seq 376 aa AA seqDB search
MNIKELSLHELCEELKTPAWNVPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRK
DITELIEFFNEIIELMPASVIKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKAL
FPPGRSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLV
LAPGTGLGSSLIYYNPMNQQHIVVPLELGSQTIPMRKDIDYIQTLHAELKLLPNYENMVS
GAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPL
TIVLVGDNIVNNAFFYRNPQNLKEMHREALNHEMERFGFQSRVTYLRQKKLLNLNLMGCY
RCGLDLSVGKKQKAQL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaaggaactcagccttcatgaactgtgcgaggagctcaagactccagcgtgg
aatgtgccgcttaccttcgttggtgatgttggcggaacgagcgcccgcatgggttttgtg
cgtgaaggaaagaacgattctgttcatgcttgcgtcacgcggtactccatgaagcgcaag
gacatcacagagcttattgaattttttaatgagatcattgaattgatgcctgcatcggta
ataaaacgggtgaaggcgggcgtcatcaatgtacccgggcctgtcacgggcggtgctgtg
ggtggaccgttcaacaatctgaagggaattgcgcgtctttcagattacccgaaggcactt
ttcccgccgggccgcagtgccattcttaatgaccttgaagcagggggctttggtgtgttg
gccgtcagtgatgcacatgttttttcggagtacttcggagtcatgtgggaaggcacacag
tggcgcacgtgtgagcaggagccggcagggtccgttattggccgtggtcgctgcctcgtc
ttggctcctggtacggggcttggttcctccctcatctactacaatcccatgaaccagcag
cacatcgtcgttccactggagcttggctcgcagactatcccgatgcggaaggatattgac
tacatccagaccctccacgcagagctgaagcttcttcccaactacgagaacatggtaagt
ggggcagggctggagttccactacaggcaggtggtgcgtgggagcaggccgccgtgctcg
gccggagagattgcgaagctcgcaagtgagggcgacgcgaacgcctgcaaggcaatgaag
aagtaccacgagtacctcatgcgcgttggcagtgaggcgagcatggcccttttgcctctc
actattgtccttgtcggagacaacatcgtgaataacgcgttcttctatagaaacccacag
aacttgaaggagatgcatcgcgaagcactcaaccatgagatggagcgcttcggtttccag
agtcgtgtgacgtacctgcggcagaagaagttactcaacctgaacctgatgggctgctac
cggtgcggtttggacctctccgtggggaaaaagcagaaggcgcaactttag

DBGET integrated database retrieval system