KEGG   Trypanosoma cruzi: 510187.100Help
Entry
510187.100        CDS       T01012                                 

Definition
glucokinase 1 (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:tcr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tcr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tcr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tcr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tcr00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:tcr00524]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 376 aa AA seqDB search
MNIKELSLHELCEELKTPAWNVPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRK
DITELIEFFNEIIELMPASVIKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKAL
FPPGRSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLV
LAPGTGLGSSLIYYNPMNQQHIVVPLELGSQTIPMRKDIDYIQTLHAELKLLPNYENMVS
GAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPL
TIVLVGDNIVNNAFFYRNPQNLKEMHREALNHEMERFGFQSRVTYLRQKKLLNLNLMGCY
RCGLDLSVGKKQKAQL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaaggaactcagccttcatgaactgtgcgaggagctcaagactccagcgtgg
aatgtgccgcttaccttcgttggtgatgttggcggaacgagcgcccgcatgggttttgtg
cgtgaaggaaagaacgattctgttcatgcttgcgtcacgcggtactccatgaagcgcaag
gacatcacagagcttattgaattttttaatgagatcattgaattgatgcctgcatcggta
ataaaacgggtgaaggcgggcgtcatcaatgtacccgggcctgtcacgggcggtgctgtg
ggtggaccgttcaacaatctgaagggaattgcgcgtctttcagattacccgaaggcactt
ttcccgccgggccgcagtgccattcttaatgaccttgaagcagggggctttggtgtgttg
gccgtcagtgatgcacatgttttttcggagtacttcggagtcatgtgggaaggcacacag
tggcgcacgtgtgagcaggagccggcagggtccgttattggccgtggtcgctgcctcgtc
ttggctcctggtacggggcttggttcctccctcatctactacaatcccatgaaccagcag
cacatcgtcgttccactggagcttggctcgcagactatcccgatgcggaaggatattgac
tacatccagaccctccacgcagagctgaagcttcttcccaactacgagaacatggtaagt
ggggcagggctggagttccactacaggcaggtggtgcgtgggagcaggccgccgtgctcg
gccggagagattgcgaagctcgcaagtgagggcgacgcgaacgcctgcaaggcaatgaag
aagtaccacgagtacctcatgcgcgttggcagtgaggcgagcatggcccttttgcctctc
actattgtccttgtcggagacaacatcgtgaataacgcgttcttctatagaaacccacag
aacttgaaggagatgcatcgcgaagcactcaaccatgagatggagcgcttcggtttccag
agtcgtgtgacgtacctgcggcagaagaagttactcaacctgaacctgatgggctgctac
cggtgcggtttggacctctccgtggggaaaaagcagaaggcgcaactttag

DBGET integrated database retrieval system