KEGG   Trypanosoma cruzi: 510187.150Help
Entry
510187.150        CDS       T01012                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tcr  Trypanosoma cruzi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    510187.150
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     510187.150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 240 aa AA seqDB search
MQHQTDILIFIGPSGGGKSTLIAYLMRTWPQQFSFCTSHTTRKPRWGEVEGKDYHFVSRN
EFRHMIHGDMFVEYNRVFSSSRQEDSASSCAGGSGGSSPIESAEDDGDYYGTSKEELHRI
LSEKKVVVLDTDITGAINVKKYCSRLITSGNGAQAAPLRVKVILVKIPSLDVLKHRLRLR
GSESDASLQKRLHAGQRCLEWCAAHPEFFQCVLVNNSLDACQKELRSFVMRNVLKVDSML
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcagacggatattctaatctttattggcccgagtgggggcggcaagtcgacg
ctgattgcgtatttgatgcggacatggccacaacaatttagcttttgtacaagtcacacg
acacgcaagccgcggtggggcgaggtggagggaaaagactaccacttcgtatcgaggaat
gaatttagacatatgattcacggcgacatgtttgtcgagtacaacagggtgtttagttct
tccaggcaagaggacagtgcgagctcttgcgctggcggcagtggcggaagcagccccatc
gaatccgccgaggatgacggggattattatggcacctcaaaagaagagctccaccgcatt
ctgtccgagaagaaagttgtggttttggacaccgacatcacgggggccattaatgtgaag
aagtactgttcccggctgatcaccagcggcaatggtgcgcaggcggcgccactgcgggtt
aaggttatattagtgaagatacccagtctggatgtactcaagcatcgtctgcgtctgcgt
ggatcggagtccgatgcgtcgctgcagaagcgccttcatgcgggccagaggtgtcttgag
tggtgcgcggcgcatccggaattttttcagtgtgttcttgtgaacaattccttggacgcc
tgccagaaggagctgcgttcgtttgtgatgagaaacgtgctgaaagttgacagcatgctg
tga

DBGET integrated database retrieval system