KEGG   Trypanosoma cruzi: 510295.50Help
Entry
510295.50         CDS       T01012                                 

Definition
protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 453 aa AA seqDB search
MSSEIEPHILRKYEIQAQLGQGAYGIVWRASDRRTHQVVALKKIYDAFQNATDAQRTFRE
IMFLQALSHPNIIKLLHVHRATNDKDIYLVFEYMETDLHVVIRANILEDIHKQFIIYQLL
KTLKYLHSAELLHRDMKPSNLLVNSDCSMKVADFGLARSILSLEKEQVARPALTDYIMTR
WYRPPEILLGSTRYTKGVDMWAVGCILAELLLGRPIFPGRTTIKQLELIINVLGEPTPED
IASTNSQFAEAMMKDIRRTHTATFAELLPKASPDALDLVQKLMRFNPNERLTAEQALEHP
YVAAFHKVQDEPSAPAPVTISLPDDTRFTMQEYRERLYQEIANARRRVRREAAAALSSKN
ESGGVVTRAHPPSSAAAPVAEERREKVRDAAVTHTSSSTVARPNSSTATRTALANGASRT
TLASRTSDATRPAHHTRPVVSRHGLNGSRTMQK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgaaatagagccgcatattctccgcaaatatgagattcaggcgcagttagga
cagggggcgtacggcatcgtttggcgtgcgtccgaccgccgcacccatcaggtagtcgcc
ctaaaaaaaatatacgatgcgtttcaaaacgcaaccgacgcacagcgcacatttcgtgag
attatgtttttgcaggcccttagccacccgaacataattaaactgctgcatgttcaccgt
gccactaacgataaagacatttaccttgtctttgagtatatggagacagacctgcatgtc
gttatccgtgccaacattcttgaggatatccacaaacagtttattatttatcaactactg
aaaactttgaagtatcttcattctgcggagttgctacaccgcgatatgaagccatcaaat
cttttggtcaacagcgactgctcaatgaaggttgcggattttggattagcgcggtcaatt
ctctctctggagaaggaacaagtggctcgccccgccctcacggactacatcatgacccgt
tggtatcgaccgccagagatcctactgggctcgacacgttatacaaagggggtggacatg
tgggctgtaggatgtattcttgctgaactccttcttggaagacccatattccctgggcgt
acaacaataaagcagctggagctcatcatcaacgttcttggcgaaccgacaccagaggat
attgcgtcgacaaactcccagtttgcggaggcgatgatgaaagacattcgacgcacacat
acggcgacgtttgcggagttgcttcctaaagcctcgccggacgcacttgacttggtgcaa
aaacttatgcgattcaaccccaatgagcgcctcaccgcagagcaggcgttggagcatcca
tatgtggctgcttttcacaaggtgcaggacgagccctcggcacctgcgccagtaactatc
tcgcttccagatgacacacgctttaccatgcaggaataccgtgagcgtctctaccaggag
attgcaaacgcaagaagaagagtccgccgagaggcggccgcagccttatcttcaaagaac
gagtctggcggcgtggtgactcgggcgcatccgccctcctccgctgcggcccccgtggcg
gaagagaggcgggaaaaagtccgtgacgcggcagtcacgcacacatcgtcttcgactgtt
gctcggcccaattcttcgaccgcaacacgtacggcgttggcgaatggggccagtcgaaca
actcttgcaagtagaacttccgacgcgacgcggcctgcgcatcatactcggcctgttgtt
tcacgtcatggacttaatggttcacgaaccatgcaaaagtag

DBGET integrated database retrieval system