KEGG   Trypanosoma cruzi: 510297.80Help
Entry
510297.80         CDS       T01012                                 

Definition
DNA repair and transcription factor protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tcr  Trypanosoma cruzi
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    510297.80
  Replication and repair
   03420 Nucleotide excision repair
    510297.80
Transcription machinery [BR:tcr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     510297.80
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 501 aa AA seqDB search
MNPSYFDQVLGYPEREGLMTECPALAFFCYQEFVAAIQGGRRVVDPLSAKDEVAVLLSAA
TVSEVTARVFATVEEGATVHPFWRTLRAALESAWDPVQGGDVHWRLYEVAGNARFYGKAM
PRMPLAQLSFQNTLDASRSVLHMTTACALAGSIDPFGEKRGQPLASMLQYYRLVPTSSET
REITSEGLSFCMQPLQQQWWTLVSVALDRILVLTKNSGVTRAELWQLLAVLFALNTSQFV
YPFPEKEKDLAAFQILARLSEVGLVYPLISGGRRCFALSPHFHHAVCWSSTAPLCTAALL
DSGGNSMGRVRREDEDTIITEANFRLYAYTKNPDLLNILNQFAERDAEVDQMIACYRVTR
RTFAAALKRGIGSSHILQFLAVKAHPSMLMHHREGDSKKASGLSVLGAGTRFKNASDIRI
DEIIPQSFCDQLMTWEKECRRLIFSRNLVLLRNVTAVQKELLLNALSSGGERHAVVHQEK
GYLVVQREAYERVLAPLIPTE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctcctattttgatcaggtgctgggctacccggagcgtgagggtctaatgaca
gagtgcccggccctcgcgtttttttgttatcaggaatttgttgccgcgattcaaggtgga
aggcgagtggttgaccccttatctgcgaaggacgaggtggcggtgcttttgtcggccgca
acagtctctgaagtcaccgcgagagtgtttgctacggtagaagagggggcgactgtccat
cccttttggcgcacccttcgagcagccttggagagcgcatgggatcccgtgcaggggggc
gatgttcactggcggctctacgaggtggcgggaaatgcccgattttacggaaaggcgatg
ccgcgaatgccgcttgctcagctctcttttcaaaacacgttggatgcgagtcgaagtgtt
cttcacatgacgacggcctgtgctctcgcaggatctattgacccgtttggagagaagcgc
ggacagccccttgcgtccatgttgcagtattatcgccttgtcccaacttcgtcagagacg
agggaaattacttctgaggggttgagtttttgcatgcaacccctgcagcagcaatggtgg
acgttggtctccgtggccctcgatcgcattttggtactgacaaaaaacagtggtgtgacg
cgtgcggaactgtggcaactattagccgttttgttcgctcttaataccagtcagtttgtt
tacccgttcccggaaaaggaaaaggatttggccgcctttcaaattctggcacgtctgtcg
gaggtggggctcgtgtatcctctcatttctggtggtcgtcgttgctttgcgctgtcgcct
cactttcatcatgcggtttgctggagctccacggccccactctgcacagctgcgctgctt
gatagcggggggaactcgatgggtcgcgttcgtcgcgaggatgaagacaccatcatcaca
gaggcgaactttcgcctctatgcttacacaaaaaatcctgatcttttgaatattctcaat
cagtttgcggagagggatgcagaagtagaccagatgattgcttgttatcgagttacgcgg
aggacatttgctgcagctttaaagcgaggtatcggctcttcgcacatcttacagtttctt
gcggtgaaggcacatccgtccatgttgatgcatcatagagagggtgattccaagaaagcg
tcgggcttgtccgtcttgggtgctggaacacgttttaaaaatgcttctgatatccgtatt
gacgaaatcattccacaatcgttttgcgaccagctgatgacgtgggagaaggagtgtcgg
cggcttatttttagtcgaaatcttgtactgcttcgaaacgttactgcggtgcagaaagag
ttgttgttgaacgctctttcctcgggcggcgagaggcacgcggtggtgcaccaggagaaa
ggctacttggtggtgcaacgtgaggcgtatgagcgtgtgttggctcctttgattcccaca
gagtaa

DBGET integrated database retrieval system