KEGG   Trypanosoma cruzi: 510297.80Help
Entry
510297.80         CDS       T01012                                 

Definition
DNA repair and transcription factor protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tcr  Trypanosoma cruzi
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:tcr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tcr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 501 aa AA seqDB search
MNPSYFDQVLGYPEREGLMTECPALAFFCYQEFVAAIQGGRRVVDPLSAKDEVAVLLSAA
TVSEVTARVFATVEEGATVHPFWRTLRAALESAWDPVQGGDVHWRLYEVAGNARFYGKAM
PRMPLAQLSFQNTLDASRSVLHMTTACALAGSIDPFGEKRGQPLASMLQYYRLVPTSSET
REITSEGLSFCMQPLQQQWWTLVSVALDRILVLTKNSGVTRAELWQLLAVLFALNTSQFV
YPFPEKEKDLAAFQILARLSEVGLVYPLISGGRRCFALSPHFHHAVCWSSTAPLCTAALL
DSGGNSMGRVRREDEDTIITEANFRLYAYTKNPDLLNILNQFAERDAEVDQMIACYRVTR
RTFAAALKRGIGSSHILQFLAVKAHPSMLMHHREGDSKKASGLSVLGAGTRFKNASDIRI
DEIIPQSFCDQLMTWEKECRRLIFSRNLVLLRNVTAVQKELLLNALSSGGERHAVVHQEK
GYLVVQREAYERVLAPLIPTE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctcctattttgatcaggtgctgggctacccggagcgtgagggtctaatgaca
gagtgcccggccctcgcgtttttttgttatcaggaatttgttgccgcgattcaaggtgga
aggcgagtggttgaccccttatctgcgaaggacgaggtggcggtgcttttgtcggccgca
acagtctctgaagtcaccgcgagagtgtttgctacggtagaagagggggcgactgtccat
cccttttggcgcacccttcgagcagccttggagagcgcatgggatcccgtgcaggggggc
gatgttcactggcggctctacgaggtggcgggaaatgcccgattttacggaaaggcgatg
ccgcgaatgccgcttgctcagctctcttttcaaaacacgttggatgcgagtcgaagtgtt
cttcacatgacgacggcctgtgctctcgcaggatctattgacccgtttggagagaagcgc
ggacagccccttgcgtccatgttgcagtattatcgccttgtcccaacttcgtcagagacg
agggaaattacttctgaggggttgagtttttgcatgcaacccctgcagcagcaatggtgg
acgttggtctccgtggccctcgatcgcattttggtactgacaaaaaacagtggtgtgacg
cgtgcggaactgtggcaactattagccgttttgttcgctcttaataccagtcagtttgtt
tacccgttcccggaaaaggaaaaggatttggccgcctttcaaattctggcacgtctgtcg
gaggtggggctcgtgtatcctctcatttctggtggtcgtcgttgctttgcgctgtcgcct
cactttcatcatgcggtttgctggagctccacggccccactctgcacagctgcgctgctt
gatagcggggggaactcgatgggtcgcgttcgtcgcgaggatgaagacaccatcatcaca
gaggcgaactttcgcctctatgcttacacaaaaaatcctgatcttttgaatattctcaat
cagtttgcggagagggatgcagaagtagaccagatgattgcttgttatcgagttacgcgg
aggacatttgctgcagctttaaagcgaggtatcggctcttcgcacatcttacagtttctt
gcggtgaaggcacatccgtccatgttgatgcatcatagagagggtgattccaagaaagcg
tcgggcttgtccgtcttgggtgctggaacacgttttaaaaatgcttctgatatccgtatt
gacgaaatcattccacaatcgttttgcgaccagctgatgacgtgggagaaggagtgtcgg
cggcttatttttagtcgaaatcttgtactgcttcgaaacgttactgcggtgcagaaagag
ttgttgttgaacgctctttcctcgggcggcgagaggcacgcggtggtgcaccaggagaaa
ggctacttggtggtgcaacgtgaggcgtatgagcgtgtgttggctcctttgattcccaca
gagtaa

DBGET integrated database retrieval system