KEGG   Trypanosoma cruzi: 510661.60Help
Entry
510661.60         CDS       T01012                                 

Definition
glycerol kinase, glycosomal (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    510661.60
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     510661.60
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   510661.60
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 512 aa AA seqDB search
MKYVGALDQGTISTRFIIFDEKQCLVAQHQIPHRQLTPQAGWLEHDPMELYRASVACIVA
AVEDLRRRVPSFEKLEAIGIANQRETTVAWDRVTKEPLYNAIVWNDLRSYEVTANVKKEL
GGGDDLFFAKMNGLRISTYFSAFKMRWMLENVPKVEEARKRGTLCFGTIDAWLLWKLSGG
KVFITDVTNASRTFLMDIRTCKWSPELCDKLGIPMACLPEIRSNSELLTYALSDEGGLST
ALRHPTPIMGSIADQQGALLGNMCFEEGESKNTYGTGCFLLMTVGERIRFSGHGLLSTVA
YQLGSKSPFIYALEGSIAGAGATIEWLKNNMKLIDDVSDCEKFAQTVSDTQGVVFVPAFS
GFLAPSWDPSARGSIFGMTLKTTRAHVLRAALLAIALQVVDVLEAMERDAEIKVQFLRVD
GGLTKNHLLMKMQSDLLGINLHRPTMAETTALGAALCAGLAAGVWKSLEEVKTISQQANV
WRVIRPAASKDSQQMLRAQWKRAKQQAKWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaggtgcccttgatcagggtacgataagtacacgatttattatatttgat
gaaaagcagtgtttggttgcgcagcatcagataccacacaggcagttgacgccgcaggct
ggctggcttgaacatgacccaatggaactgtatcgcgcgagcgttgcctgcattgttgcc
gcggttgaagatttacggcggagagttccatcttttgagaaacttgaggccataggcatt
gcgaatcagcgtgagacgacggtggcatgggatcgtgtgacaaaggagccgttgtataac
gcgattgtatggaatgacttgcgctcgtacgaagtgactgcaaatgtgaaaaaggagttg
ggtggtggtgatgatttgttttttgccaaaatgaatggtttgcggataagcacatatttt
tccgcatttaagatgcgctggatgcttgaaaacgtcccaaaggtagaggaggcgcgtaaa
cgtggtactctctgctttggaaccattgatgcatggttgctctggaaattaagtggtggt
aaggtgtttattacggatgttacgaacgcctcacgtacgtttttgatggatatacgaaca
tgcaaatggtcccctgagctttgtgacaaacttggcatccccatggcgtgcctgcctgaa
atccggagtaacagcgaactgttgacttatgcgctcagcgacgagggaggtttatccacg
gctctgcggcacccaacaccaatcatggggagcattgctgatcagcagggtgcactcctt
ggaaacatgtgttttgaagaaggagaatcaaagaatacgtatggtactggctgctttctt
ctaatgacggtgggggaaaggatccgtttttcaggccatggtcttctctccactgttgcc
tatcagcttggcagcaaatccccgttcatctatgcccttgaaggctccattgccggagct
ggcgcaacaattgaatggttgaaaaataacatgaagctcattgacgatgtctcggactgt
gaaaagtttgcccaaaccgtctctgatacgcaaggtgtcgtgtttgtgcctgcgttttcc
ggttttttggcacccagttgggatccttccgcccgtggatccatttttgggatgacattg
aagacgacccgtgcccacgttcttcgcgctgctctgttggccattgcccttcaagtcgtt
gatgttttggaagcgatggagagggacgcggaaattaaagtccagtttctccgcgttgat
ggagggctaaccaaaaatcatctgctaatgaagatgcagtcagacctgttgggaatcaat
cttcatcggccgactatggctgaaactaccgcactcggtgccgcgttatgcgctggcctg
gcggcaggcgtctggaagtctctggaagaagtaaaaacaatatcgcaacaagcgaatgtt
tggcgtgtgatcagacctgctgcatccaaggattctcaacagatgctaagggcgcagtgg
aaacgagcaaagcaacaggcgaagtgggccaagctttaa

DBGET integrated database retrieval system