KEGG   Trypanosoma cruzi: 510661.60Help
Entry
510661.60         CDS       T01012                                 

Definition
glycerol kinase, glycosomal (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tcr00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 512 aa AA seqDB search
MKYVGALDQGTISTRFIIFDEKQCLVAQHQIPHRQLTPQAGWLEHDPMELYRASVACIVA
AVEDLRRRVPSFEKLEAIGIANQRETTVAWDRVTKEPLYNAIVWNDLRSYEVTANVKKEL
GGGDDLFFAKMNGLRISTYFSAFKMRWMLENVPKVEEARKRGTLCFGTIDAWLLWKLSGG
KVFITDVTNASRTFLMDIRTCKWSPELCDKLGIPMACLPEIRSNSELLTYALSDEGGLST
ALRHPTPIMGSIADQQGALLGNMCFEEGESKNTYGTGCFLLMTVGERIRFSGHGLLSTVA
YQLGSKSPFIYALEGSIAGAGATIEWLKNNMKLIDDVSDCEKFAQTVSDTQGVVFVPAFS
GFLAPSWDPSARGSIFGMTLKTTRAHVLRAALLAIALQVVDVLEAMERDAEIKVQFLRVD
GGLTKNHLLMKMQSDLLGINLHRPTMAETTALGAALCAGLAAGVWKSLEEVKTISQQANV
WRVIRPAASKDSQQMLRAQWKRAKQQAKWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaggtgcccttgatcagggtacgataagtacacgatttattatatttgat
gaaaagcagtgtttggttgcgcagcatcagataccacacaggcagttgacgccgcaggct
ggctggcttgaacatgacccaatggaactgtatcgcgcgagcgttgcctgcattgttgcc
gcggttgaagatttacggcggagagttccatcttttgagaaacttgaggccataggcatt
gcgaatcagcgtgagacgacggtggcatgggatcgtgtgacaaaggagccgttgtataac
gcgattgtatggaatgacttgcgctcgtacgaagtgactgcaaatgtgaaaaaggagttg
ggtggtggtgatgatttgttttttgccaaaatgaatggtttgcggataagcacatatttt
tccgcatttaagatgcgctggatgcttgaaaacgtcccaaaggtagaggaggcgcgtaaa
cgtggtactctctgctttggaaccattgatgcatggttgctctggaaattaagtggtggt
aaggtgtttattacggatgttacgaacgcctcacgtacgtttttgatggatatacgaaca
tgcaaatggtcccctgagctttgtgacaaacttggcatccccatggcgtgcctgcctgaa
atccggagtaacagcgaactgttgacttatgcgctcagcgacgagggaggtttatccacg
gctctgcggcacccaacaccaatcatggggagcattgctgatcagcagggtgcactcctt
ggaaacatgtgttttgaagaaggagaatcaaagaatacgtatggtactggctgctttctt
ctaatgacggtgggggaaaggatccgtttttcaggccatggtcttctctccactgttgcc
tatcagcttggcagcaaatccccgttcatctatgcccttgaaggctccattgccggagct
ggcgcaacaattgaatggttgaaaaataacatgaagctcattgacgatgtctcggactgt
gaaaagtttgcccaaaccgtctctgatacgcaaggtgtcgtgtttgtgcctgcgttttcc
ggttttttggcacccagttgggatccttccgcccgtggatccatttttgggatgacattg
aagacgacccgtgcccacgttcttcgcgctgctctgttggccattgcccttcaagtcgtt
gatgttttggaagcgatggagagggacgcggaaattaaagtccagtttctccgcgttgat
ggagggctaaccaaaaatcatctgctaatgaagatgcagtcagacctgttgggaatcaat
cttcatcggccgactatggctgaaactaccgcactcggtgccgcgttatgcgctggcctg
gcggcaggcgtctggaagtctctggaagaagtaaaaacaatatcgcaacaagcgaatgtt
tggcgtgtgatcagacctgctgcatccaaggattctcaacagatgctaagggcgcagtgg
aaacgagcaaagcaacaggcgaagtgggccaagctttaa

DBGET integrated database retrieval system