KEGG   Trypanosoma cruzi: 510689.40Help
Entry
510689.40         CDS       T01012                                 

Definition
phosphatidylinositol 3-kinase tor
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tcr  Trypanosoma cruzi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 2434 aa AA seqDB search
MSTSSGRDGLASTIRRIANDPEKRAVMVEDEIKRIKELQRKNLQEYENTISSLLVCLESF
DVVQSVAPEIKCALTVLDILLGLGLTTIQMSQCNSYARLCLCALNDTSLAPAAAQTFAKT
LVDGMASDFARGEIDESLSWIELSDVTMRARRMCGLLVLREVALRIPMLILSKLNILFEK
LWSGLASSDEMIRDTSTQLFKVCGKLLSSRSPTLRAKTVDALLHQLKSNLAAKSRDCNLA
GLLAFETVVMSSMGCPSQPRYEDLSIMLLPYVMSGGSSTNSEIVRKLLFHCLVVLCRYST
TLFIANQLKDTVSFALKSIRNLFQHCAAFDMLSEIIPMVGKGAFTPFAKETCEAVRFISE
RSPTPCWESLKCFSVIFRECPFADVESYIESCIENIFNWGLSSQLIECMRDIISSSSTKC
RTKLEEALLDMISVTLCGLPFRQVTGTRTKDVIYPELEPTESQIVVALNALIQFGFSDSE
LMGDFLRDSVLPLIDNPSASVRNAAISTIVSLLIPPGIKGELTMARRICVDMIVSRMLVV
GLANPDPVIRATILSSFTPSFYPYLSELQFLTQLFSALGDEDIRCRIAATELLCRMVSHD
PSHILPVFRKEVLHILYALSRDDNKNTVLNGLLLLDAVASNAPQFVVNLTDGIVKALGLH
FTSLEIHSQKLQPLLRCCTSVARAVRFFGHNKPVFTNEVERVCELLDMLPLDTEFATSRL
WCLRFLGAALGPQIGGRSPYDVYPHLYRRLSGILKNSDDDLNLRLEALRCAGTIGALDTS
VFQSLGLGHSTHQIKLERGTSHALSHAMCCRYVLRAIASLLDPNEKRVSVNKDTLLRIGI
QTILQIGESCPCSRAEMTVVIHPVVRAASELSAGRLLGVVLYELTQIIKYVGAAALSEVN
VLYTFFDVVWDRCPAYRFLIVRLASTIASFRDKGDQKYRQSDARVIPIKFDALNDADSSE
FLRYAILEYIVRHTETLRFCAEIVVLNLLRATQRSSVDFVVYVVTALRVVCWRLNADELA
GVIVRGLLSALKLHSSALTRVTEYTSFTDRIMSVFCVLIVQLQGEFIKYSSEVIQTLKTL
RISNSEFTTLQGLLIKGFRCALSETSLKEHHDQVVSLLKKCKSMAVRGISRLGEVWSARS
NTEDTTAAFGDDERPLPVAEQRIINTIKTVSLTKEEWLRWIDHFSISVMQESPYRVFRCV
SLPIGTNATSLVERSPEFTQDILRLAFRALWNFGSASIRSSIVDFFRQTLQQPIWTSAVP
DDVITGMLSLIEYMDIVGMTLPIAANDLSECAWRRGMLAKALYWREAAYREDPASTVESL
IILYSELHQRDSAVSILSQANENQKRNLLQQSGLLKLAGYTEFLQLTQREIDRDFVGSET
SSESLARPLPYRSKNFRRIRGVAGRSLSDVNGSFRSEDATLDLHLEREVRQMVSLSEFGE
YDEVIRQWEAVFKRHKEKKVENEDNILFYVSQYAADASIRLQSWSTLEDTLLWMPRDSVQ
YHIARAAFFIHKGQYDEAFLAVDEGRKLLLDDLSGLLHESYIRAYEILVIAQELSELEEV
MTAKRAKETSSMEHFRRISRLWDQRIEMMSPTVPVWKQVLSVRGLLIPPSEDVTTQLRFV
KLCRRENAKQLERFTLFQLLGHRCPTYEQLMSCNANPRVVMQYISFLSANGELGPKSPYG
LESDLLKKLIDTHSKVENTILLSRAYARLGTKTELKEAIECYKAATLYDPNWFHAWRMCA
EANVELLNTSYSEAAYAAAIEGYIQSIKLGNSDSTMIQDVLKLLTLLSRHSDSDKGLIKL
REKVLDVSSRAWYLVVPQLIARLDSGSDDSCQLIADILTSVVFDYPLSLIYPLNLCAMSD
SERRKKLATMILEKLKSKFPVIVLQGRILIDELLRISDLVYEKWYDRLDTAATAFFGRRN
CHEMVETLLPMHEELNRAPETIVEAEFTCKYSSRLQEAREWLKSYTRTESIADLHSAWHI
YHGVYRQIDEQIKSQNRLQLPFCSPKLFEARNLSVGIPDAMPTDDGNVSCIASFNDTLVV
IASKQRPKRLSVITTEGKKQKYLLKGREDLRLDERVMQLFRLVNTLMMSDSRTCKNFGFQ
IQRYSVTPLKDTVGIIGWVGGCDTFHELVKKYRTSRGVPCELELRMLNQIIVFDQPKAYD
FLTIMSKVEVMEFLADHTTGHDIRKAMWASAASCETWLEQRQVFTTSLATTSVVGYILGL
GDRHPNNMMIQRTSGLVVHIDFGDCFEVAMTRDKFPEKVPFRLTRMLRNALDVSGVDGAF
RTIAETAMWVLRDGSHSVLAILEAFIQDPLISWRLMNRPGEEPQASADHQAFEQMGARKL
YSPAAFTGDPPRDSVSTLAIKTAYVASVGEEIDMVHKGVTIFERVRSKLKGEDFLQKKGG
TASMDPKVQVARLIAEATDITNVAQSWSGWYPFW
NT seq 7305 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatcgtctgggagggatggtctggcgtcgaccattcgcagaattgcaaatgac
ccagagaaacgtgctgttatggtggaggatgagatcaaacgtataaaggaacttcaaagg
aagaatttgcaagaatatgaaaacacaatttcttccttgttagtgtgcctggaaagcttt
gatgtggtgcagagcgttgcgcctgagattaaatgtgccctcaccgtgcttgacatactg
cttggtcttggattgacgactattcaaatgtctcaatgcaacagttatgcccgactttgt
ctctgtgcactaaatgacacttctcttgcgccggcggctgcgcagacatttgctaagaca
cttgtagacggtatggcatcagactttgctcgtggtgagattgatgagtcgctttcatgg
attgagttgagcgacgtcactatgcgagccagaagaatgtgtgggttgctggttctgcgg
gaggtagcgctacggattccaatgctgatcctttccaagttaaatattctctttgaaaaa
ttgtggagtggtttggcctcatcggatgagatgatacgtgacacatcgacgcaattattt
aaggtgtgtggaaaattacttagtagccgatcaccgacgttgcgtgccaaaacagtagac
gcattacttcaccagcttaaatccaatctcgccgcaaagtcacgagattgcaatttggct
ggcttgctagcttttgagacggtagtgatgagctcaatgggttgtccttctcagccacgt
tatgaagatttgtccattatgttgctaccctatgtcatgtctggtggatcttcaacgaac
tccgaaattgtgcggaagcttctttttcattgtcttgttgtgctttgccggtacagcacg
acattgtttatagccaatcaactgaaggacacggtgagttttgccctgaaatctatccga
aacctgttccaacactgtgctgcttttgacatgcttagtgaaattatcccgatggttggt
aaaggagcctttacgccttttgcgaaagagacatgcgaagccgtccggttcatatctgaa
cgttcccctacaccatgctgggagtcactgaagtgtttctcggtgatatttagagagtgt
ccgtttgcggatgttgagagttatatcgagtcatgcatagaaaatatttttaactgggga
ttgtcatcacagctgattgagtgcatgagagacattatttcgtcttccagcacaaaatgc
cggacgaaactggaggaggcgcttttggacatgatttctgtgacgctttgtggtttacca
tttcgccaggttacggggactcgaacaaaggatgttatttatcccgaattggagccaaca
gagagccaaattgtggtagcgcttaacgcattgatacaatttggattttctgattctgaa
cttatgggtgactttcttcgtgattccgttcttccgctcattgataatccgagtgcgtct
gtgcggaatgctgccattagcaccatcgtttctcttttgattccgcctggaataaagggt
gagttgacgatggctcgtcgaatatgtgtggatatgattgtctcacgcatgcttgttgtt
ggactggcaaacccggatccggtgatacgagcgaccattctctcctcttttactccttca
ttttatccgtatctcagtgagttgcagtttttaactcagttattttcggcacttggggat
gaagacatacggtgccgtattgccgcaacggagttgttgtgtcgaatggtgagtcatgac
ccgtcgcatattttgcctgttttccgcaaagaggtcctacatattctttacgcactctct
agagacgacaataaaaatactgtactaaatggacttcttttgttagatgcggttgcgtcc
aacgctcctcaatttgtggtgaacttaacggatggcatcgttaaagctcttgggcttcac
ttcacatcgcttgagattcactcgcaaaaattacaaccacttcttcgttgttgtacttcc
gtcgctcgtgcagtgcgtttttttggtcacaacaaacccgtttttacaaatgaggtggag
cgtgtttgtgagttgttagacatgctcccgctcgatacggagtttgctacctctcgttta
tggtgtctgcgatttcttggcgccgctctcggtcctcaaattgggggccgttcaccgtat
gatgtatacccacacctgtatcgtcgtctttctggaatactaaagaatagtgatgatgac
ctgaatttgcgccttgaggcactacgctgtgccgggactattggagcattggacaccagt
gtctttcagtcactgggtttaggccacagtacacatcaaattaaattggaacgaggcacc
tcacatgcacttagtcatgcaatgtgttgccgttatgtgttaagggccattgcttctttg
ctagatccaaatgagaaacgagtctcggtgaataaggacaccttgttgcgaataggcatc
caaacgattctgcagattggcgaaagttgcccgtgttcacgtgctgaaatgacagttgtg
attcaccccgttgtgcgtgctgctagtgaacttagcgctggacgccttcttggcgttgtc
ttgtatgagttgacacaaatcataaagtacgttggggcggctgcgctttcagaggtgaac
gttctttatacgttttttgatgtggtctgggacaggtgtcctgcatatcgctttcttatt
gtacgtcttgcctcaacaattgccagctttagagacaagggagatcagaagtatcgacaa
agtgatgctcgtgtaattcccattaagtttgatgccctcaatgatgccgattcctccgag
tttttgagatatgctattctagagtacattgtgaggcacacggaaacacttcggttctgt
gctgagattgttgttctcaacctacttcgtgccacacagcggagctctgtagactttgta
gtgtatgttgtgacggctcttcgtgtggtgtgctggaggttaaacgcggatgagcttgct
ggtgtcattgtgcgtggacttcttagtgccttaaagttgcattcgtcagcccttacgagg
gtcacggagtatacatcttttacggatcgaatcatgagtgtcttctgtgtgctgattgtc
cagctacagggagagtttattaaatactcttcagaggttatccaaaccctcaagacgctc
cgcatatccaactctgagttcacgacgctgcaagggctattaataaaaggatttcgttgt
gcgctgagtgaaacttcactaaaagagcatcacgatcaagttgtatcccttcttaaaaaa
tgtaaatcgatggctgtgcgaggaatatctcgacttggagaggtatggagtgcaagaagt
aacacggaagacacaacagcggcatttggcgatgacgagcggcctttgcccgtagcggaa
cagcgaatcattaacacaattaaaacggtttcactcacaaaagaggaatggcttcgatgg
atcgatcacttctccatatctgtcatgcaagaatcaccataccgtgtgtttcgttgcgtt
tcgctacctattggaactaatgcaacttctcttgtagaaagatcgcctgagtttacacag
gatattttgcgtcttgcatttcgtgccctttggaactttggaagcgcatctattcgctcc
tctattgtggacttttttcgacaaactctacaacaacccatatggacctcggccgtaccg
gatgatgtcatcaccggaatgctttccctgatagagtatatggacattgttgggatgacg
cttcccatagcagcaaatgatctttctgaatgtgcatggcgccggggtatgctggcaaag
gcgctttattggcgtgaagccgcctaccgtgaggatcctgcaagtacggtagaatccctt
attatcctttatagtgaattacaccagcgtgattctgctgttagtattcttagtcaggca
aatgaaaatcagaaacggaatttacttcaacaatcaggacttctcaagcttgccgggtat
acagagttcttgcagcttacacagcgagagattgacagagactttgtgggttctgaaact
agtagtgagagtttggcgagaccactgccgtaccgatcaaaaaattttagacgtattcgc
ggagttgcaggccgttcactatcagatgttaatggatcctttcgtagtgaagatgcgact
cttgacttacatttggagcgagaggtaaggcaaatggtgagtttaagtgaatttggagaa
tatgacgaggtgattcgtcaatgggaggcggtttttaagaggcataaggagaagaaggtg
gaaaatgaggataatattcttttttatgtctcacagtatgctgcagacgcctccatacga
ttgcagtcgtggagtacgttggaagacacgttgttatggatgccgcgggatagtgtgcaa
taccacatagcacgggctgcgttttttattcacaagggtcagtacgatgaggcttttttg
gctgtggatgaaggccgtaaacttctgctagatgacctttctggacttttgcatgagtct
tatataagagcctatgaaattcttgtaattgcacaggaattgtctgagttggaggaggtg
atgacggcaaaacgcgccaaggaaacgtcatccatggaacactttcgtcgtatttcacga
ctttgggatcaacgtatcgagatgatgtcgcctactgttcctgtgtggaagcaggttctc
agcgtgaggggactacttattcccccaagtgaggacgtcacaacacaactgcgttttgta
aaactctgtcgacgtgaaaatgcgaagcagttagaacgcttcaccttatttcaacttctt
ggccaccgctgtccaacttacgagcagttgatgagctgcaatgccaacccacgtgtggtg
atgcaatacatcagttttctttccgcgaatggagagttgggtccaaagagcccgtatggt
cttgagagcgatcttcttaaaaaactgattgacacgcattccaaggtggagaacacgatt
ttactctctcgcgcctatgctcgcctcggtactaagacagagctgaaagaagccatagaa
tgttacaaggccgcaacgttgtatgatcccaattggtttcatgcatggcgtatgtgtgct
gaggcgaatgttgagcttttaaacacgagctactctgaagctgcgtacgccgcggcaatt
gagggttatattcaaagcatcaagttgggaaactcggactctacgatgattcaggatgtg
ctgaagttgctcacgttactgagtcgccactcggattcagacaaaggactgataaagttg
cgtgaaaaagtgttagatgtctcatcacgagcatggtatttagttgtacctcaacttatt
gctcgcctggactctggatcagatgacagctgccaacttattgcagatattttgacttcg
gtggtctttgattacccactttctttgatatatccgttgaatctgtgtgccatgtcggac
tcggagcgacgcaagaaattggcaaccatgattcttgaaaaattgaagtctaagttccct
gtcattgttcttcaaggtcgtattcttattgatgagcttcttcgtatatcggatttggtc
tacgagaaatggtatgatcggttggatacagctgcaacggccttttttggccgtagaaac
tgtcatgagatggtggagacgttattgccaatgcatgaggagcttaatagagcgccggag
acaattgttgaagccgaattcacatgtaaatacagcagccgccttcaagaagcacgcgaa
tggctgaagtcctacacgcgaaccgaatcgattgcggatttacattccgcttggcatata
tatcatggagtatatcgacagattgatgaacaaataaagtctcagaatcgattacaatta
ccattttgtagtccaaaactttttgaagcgcgaaatctttcagtaggcattcctgatgct
atgccgacggatgatggtaatgtttcttgtattgcttcttttaacgacacccttgttgtt
attgcgagtaagcagaggccaaagcgtttaagtgtaataacaacggaaggtaaaaaacaa
aaatatcttctaaaaggacgagaggatttacggcttgatgagcgcgttatgcagctcttt
cgtcttgtgaatacgctgatgatgtctgactcaagaacttgcaagaattttggttttcag
attcaacgttactctgtgactccactgaaggacacagttggaattatcggttgggtgggt
ggatgtgacacttttcacgagttggtcaaaaagtataggacttctcgtggcgtcccttgt
gagttagaattgcgaatgctaaatcaaattattgtctttgaccagcccaaagcatatgac
tttcttaccatcatgtccaaggtggaggtaatggagtttcttgccgaccatacgacagga
catgatattcgcaaagctatgtgggcttctgctgcaagctgtgagacttggttggagcag
cgacaggtgtttactacatccttggcaaccacaagtgtggtagggtacatattaggtttg
ggtgatcgtcatccaaataatatgatgatccaacgtacatctggtttagttgttcacatt
gattttggcgactgttttgaggttgccatgacacgtgacaaatttcccgaaaaggttcct
tttaggcttactcgaatgttacgaaatgcattggacgtttcaggtgttgacggggcattt
cgtacgattgcagagacggccatgtgggtattacgtgatggaagtcacagtgtccttgcc
atactggaggcctttattcaagatccacttatctcatggcgactgatgaatcgaccagga
gaggaaccacaggcatcggcagatcaccaagcctttgaacaaatgggagccaggaaactt
tattcaccggctgcattcacaggggatccccctagggatagtgtctcaacattggctata
aaaacggcctacgttgcatctgtgggggaggagattgacatggttcataagggcgtgact
atctttgagcgtgttcgttcaaagttaaagggtgaagattttctgcagaagaaggggggt
accgcaagcatggatcccaaggtgcaggtggctcggctcatagcagaggcgacagacatt
acaaatgttgcgcagtcatggtctgggtggtacccgttttggtag

DBGET integrated database retrieval system