KEGG   Trypanosoma cruzi: 510691.10Help
Entry
510691.10         CDS       T01012                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tcr  Trypanosoma cruzi
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tcr00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 282 aa AA seqDB search
MDAFNPISEAQRLQEEQEILERDRKRQQEKEERERRAAQEKEAEERRKREEMERLIEAEK
RRIKQEEEWRKLGTDIIQNLPPVPPSVVSEGLVQAWYLDDETSKPTLRTASLKKGKKRDT
PPVTLQQLKDLGVIYYDINLNDFSIVRQLVKERLYKHTDEVHISQTCKDESFLERWFQEH
FNEDEQIRIVIDGSCYFDVRSKQDKWIRIYAKAGDLFIFAPGLYHRGTLDEDDYVALYRL
FRDSPRFAPFFRSDARAESQKVRLNYLMSLKKGNVAAEIGFR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctttaatcccatctctgaggctcagcggctccaggaggagcaggagatactt
gagcgtgacaggaagcggcagcaggagaaagaggaacgtgagcgacgtgcggcacaagaa
aaagaggcggaggagcggaggaagcgagaggagatggaacgccttattgaggcggagaag
agacgtataaaacaggaggaggaatggcgcaaacttgggacggatatcattcagaacctt
cctcccgtaccaccctccgttgttagcgagggtctggtacaagcatggtaccttgacgac
gaaacctcaaaaccaacacttcgaactgcgagcttaaaaaaggggaagaaacgtgacact
ccgcccgtgacgctgcagcaactgaaggatctcggcgtcatttactatgatataaacttg
aacgacttttccattgtcaggcagttggtgaaggaacgcctttataagcatacggatgag
gtgcatatttcacagacatgtaaagatgagtcgtttttggagcgttggttccaagagcac
ttcaacgaggatgagcaaattcgcattgtgattgacggctcctgttactttgatgtgcgc
tccaagcaggataagtggattcgtatttatgcaaaagcgggagatttgtttatttttgca
ccaggtctttatcatcgtggcaccctggatgaggatgactacgttgcactctaccgtctt
tttcgcgattctccacgttttgccccctttttccgctccgacgcacgggccgagtcgcag
aaggtacgtctgaattatttaatgtcactaaagaagggaaatgttgcggcagagattggg
tttcgctga

DBGET integrated database retrieval system