KEGG   Trypanosoma cruzi: 510761.70Help
Entry
510761.70         CDS       T01012                                 

Definition
ubiquitin hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     510761.70
Peptidases [BR:tcr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   510761.70
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 1166 aa AA seqDB search
MLNVLDIVRHVFWNDQLFDRDLLPPEADLEKCQTTLADLATMTGAERIAVFRECGIHNSL
HPVFLRALQRLTAIHGSGKIADNYMLHHHLSAHNWSPSLSSAHLLGYSFVNSEAFSTEKV
DGPIPRPKGKMVLDSGGAISKTKYNGLLNQGATCYLNSLLQALFHISEFRWTIYQMPTGE
EAEEKNDTGVKRTKSIPYALQRLFCLLQRGNEAVDTTELTESFGWSSTDSFIQHDVHEMT
CKLLDNLENKLNHVQQSEKGDHSSHTKNNAISQLFVGVLENFVCVDEVGYHGSREELFYD
LQLVVKNTTDIYTSFERFFQVEVLDGKNKYCLENNGKKSYHRAEKGVRLKLTPPILLLHL
ARFDYDIERGETKVLSRWDYYNNLDLSKYMPHASKEDTDYTLCSVLVHSGSDAGFGHYFC
FLRCSDAWYRFNDEDVSPASLREVFGANFGGFKLNYWGSEVPNTTNAYMLVYIRTSQIGH
LLRSIGPEDVPWHVVRQLEWEQKEYERLLKERAEDHLYGKIYFIQPNDIEEEHEFLSCRR
PQGKQFPTNTTFRVLLSTEALPAFQSFVEKQIGIPISEQLLWYPSERGENGHVFLHKQVI
QGVTVSDILCGEKDCCVFVVTPSTVNYIEADGIEEGDSVKYDLLHHKLYIPLHLKVVFLG
CTVLAYKKRVTSAKAIQLMEPFIRKRITEIPADVNLRPNHHLTGGGSKCTIDPETSAAPS
NERPLGAWTVPPEKIEAEKREGLSVLCEYDHNAYSKCSPYLNSGDILVWQEAISEEDKSG
VFYPDIVSFQQFLRRLVPVEIKLNHPPSYSTLINTQLAENMTYEQLQRYVARLIGDPENY
DRIRFTMHSPETKLPYFMKGRKKDRPTLGKLLSPPVPRYVALSRYLYYEYCKYTVTEIEA
AHSLQFKLFNERVKPISQHWILMPREIPITPVELFSTCVREIQEVKSNSVHSFPTTPVLP
KTEKEKELQERDVLDSDMMFYQDLDPDGAWKELRLVDVWRGRIYNVFDKDHPRTFENSTF
EESAEYRIEKIPRPIEGVPLQNQSLIHVHHFTMVRQRSNSVETHGDPFSIYIDHAEFAPG
LLRRIAYKLGLSEAAVVDWKLALVRENYVVEVQPGVPLGKQLFEFSLESQYQPNQQYPLK
MAFLGLEHAPLLKRPVKRDSRVVILN
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgtgcttgacattgttcgacacgttttttggaatgatcaattatttgatcga
gatttgttgcctccagaagctgatttagagaaatgccaaaccacattggccgatttggcg
acaatgactggcgcagagcgcattgccgtatttcgggaatgtggtatccacaattctctt
catccggtctttcttcgggctttgcaacgtttgactgcgattcatggatcgggtaaaatc
gccgacaactacatgcttcatcatcatttgagtgcacacaattggagtccttctttatct
agtgcacatcttcttggctattcttttgtaaacagtgaggcatttagcactgagaaagtt
gatggacccattccccgtcctaaaggaaagatggttttagatagtgggggtgctatttca
aagaccaaatacaatggattgttgaatcaaggagcaacatgctatttgaattctctttta
caagcattatttcatatctcagagtttcgatggaccatttatcaaatgccaactggagag
gaggcggaagaaaaaaatgatacaggtgtcaaaagaacgaaatctattccatatgctctt
cagagattattttgtcttcttcaaagaggaaacgaggcggttgacactacagagcttacc
gaatcctttggatggagttcaaccgatagcttcattcaacatgatgttcacgagatgaca
tgtaagttattggacaatttagaaaataaattgaatcatgttcaacagtctgaaaaagga
gatcactcatctcatacaaagaataatgccatcagtcaattatttgttggagttttggaa
aactttgtttgcgtggatgaagtgggttatcacgggtcgagagaggaattattctatgac
ctccagttagttgtcaaaaacacaactgatatttacacaagttttgagcgattttttcag
gttgaggtacttgacggaaaaaacaaatactgcttggagaataacgggaaaaaatcatat
catcgagcagaaaaaggtgtgcgtttaaaacttacaccacctattttgcttctgcatttg
gcacggttcgactacgatatagaacgaggggaaaccaaggttttgagtcgttgggattac
tacaacaatttggatttatcgaagtatatgccccatgcttccaaagaggatacagattat
acactttgtagcgttttagttcattctggatctgatgctggatttggtcattatttttgc
tttttacggtgctcagatgcatggtatagatttaatgacgaagatgtttcaccagcttct
cttcgagaagtttttggagcgaattttggtggatttaaactcaattattggggttcagaa
gttccaaatacgactaacgcttatatgttagtttatatacgaacttctcagataggacat
ttattaagatctattggaccagaagatgtcccatggcatgttgtgcgacaactagaatgg
gaacaaaaagaatatgaacgacttttgaaggaaagagctgaagatcatctatacggaaaa
atttatttcatacaaccaaatgatattgaagaggagcatgagtttctttcctgtcgtcga
ccgcaaggtaaacagttcccaacaaatactacttttagagttctattgagtacagaagct
cttcctgcgtttcaatcgttcgtcgaaaaacaaattggcatacctatttctgagcagtta
ctttggtatccttcagagaggggtgaaaacggtcatgtttttttacataaacaagttatt
caaggcgtaactgtatcggatattttgtgtggcgaaaaggattgctgcgtttttgttgta
actccctctactgtcaattatattgaagccgatggcattgaagagggtgactccgttaaa
tatgacttgcttcatcataaactatacattcctctgcatttgaaagttgtctttttggga
tgtacagttctggcctacaagaaacgtgtgacgtcagcgaaggccattcagcttatggag
ccatttattcggaaacgtattacagagattcccgctgatgtaaatctaagacccaaccac
catttaactggaggaggatcaaaatgcacgattgaccctgaaacatcagctgctccttcg
aatgagagacctttgggtgcatggacagttcctcctgaaaaaattgaagccgaaaaaagg
gaggggttatctgttttgtgtgagtacgatcacaatgcctattctaaatgttcaccgtat
cttaattccggagacattttagtttggcaagaggcgatctctgaagaagataaaagtggt
gttttctatcctgacattgtgagcttccagcaatttcttcgacgactggttcctgtggag
atcaagttaaatcatccgccctcatattcaacgctgatcaacacacaactagcagaaaat
atgacatatgaacaacttcagcggtacgtggctcgtcttattggtgatccagaaaactat
gaccgtatccgttttacaatgcacagccctgagacgaagctgccatattttatgaagggg
aggaaaaaagatcgcccaactcttggaaagttgctatcacctccggttccacgttatgtc
gcgctttcacgatatctttactatgaatattgcaagtatacagtgacggaaattgaggca
gcacattctcttcaattcaaattatttaacgagcgcgtgaaacctattagtcaacattgg
atattaatgccgcgagaaattccaataacaccggtggaacttttcagtacgtgtgttaga
gagattcaggaggtgaaatctaattctgttcattcatttccaacaactccagttttgccg
aaaactgagaaggaaaaggagctacaagagcgagatgtgcttgattctgatatgatgttt
taccaggatcttgatcccgacggcgcatggaaagaacttcgactcgtagatgtatggcgt
ggaagaatctacaacgtatttgacaaggatcatccacgcacatttgaaaattccacattt
gaagagagcgcagagtatcgtattgaaaaaataccgaggcctatcgagggcgttcctttg
caaaatcaatcactaattcatgtacaccattttaccatggttcggcagcggtcaaattct
gttgagactcatggagatccttttagcatttacattgaccatgcggaatttgcacctggt
cttttgcgacgtattgcatataaactagggctttctgaggcggccgtggtggattggaag
ttggcgttggtaagggagaattatgttgtggaggtccaacctggtgtgccattaggaaaa
cagctgtttgaattttctcttgaatctcaatatcagcccaaccagcaatatcctctcaag
atggcattcttaggtcttgagcacgcccccttgttgaagcgtccagtaaagagggatagt
agggtggtcatcctcaattag

DBGET integrated database retrieval system