KEGG   Trypanosoma cruzi: 510821.50Help
Entry
510821.50         CDS       T01012                                 

Definition
replication Factor A 28 kDa subunit
Orthology
K10739  
replication factor A2
Organism
tcr  Trypanosoma cruzi
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    510821.50
   03420 Nucleotide excision repair
    510821.50
   03430 Mismatch repair
    510821.50
   03440 Homologous recombination
    510821.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 264 aa AA seqDB search
MNLNAYGFSGQTASNAGNGAVGAAAGSNQPQRRMHPIRPVTIKQLLEAQRVGEGVMVVDG
REVTQATVVGRVIGYEDDTTNRVTGALTAKHYGYRITDGTGLVVVRQWMDADHQEEPLPV
QCYVRASGTVKVWQNAPIVTGTVRLVSDCNELNYHYLDVILTHLRLTRGDKHAKEEGAVP
AVSNTASTLGVQNMLPGGGGKVFATDVLLNAIKQNARGDAGLSMDELAAAARQYGFSVND
VRVALRTLAAEGSVYQTHDNRFNI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaaacgcatatggattttccggccagaccgccagtaacgccggtaacggcgcc
gtcggggcggcggccggcagcaatcaaccgcagcgtcgtatgcaccctatccgcccggtg
actataaaacagctgctggaggcgcagcgtgtcggtgagggtgtgatggttgtcgacggc
cgcgaggtcacgcaggcgactgtcgttggtcgtgtgatcggctacgaggacgacacgacc
aaccgagttaccggcgccctcaccgcgaagcactacggttatcgtatcaccgacggcact
ggtcttgttgtggtgcgtcagtggatggacgcggatcatcaggaggagccccttcccgtg
cagtgctacgtgcgggcctctggcaccgtcaaggtgtggcagaacgcccccatcgtgacc
ggcaccgtgcgccttgtctccgattgcaacgaactcaactaccactacctcgatgtcatt
ctcacacacctgcgactgacgaggggcgacaaacacgcgaaggaagaaggcgcggtcccg
gctgttagcaacacggcgagcacgctaggggtacaaaatatgctgccgggtggcgggggc
aaagttttcgcaacggacgtgcttctgaacgcgatcaaacaaaacgcgcggggtgatgcg
gggctctcaatggatgaacttgccgctgcggcacggcagtatgggtttagcgtcaatgat
gtccgtgttgcgttgaggacactggcggcggagggaagcgtgtaccagacgcacgacaac
aggtttaatatttag

DBGET integrated database retrieval system