KEGG   Trypanosoma cruzi: 510821.50Help
Entry
510821.50         CDS       T01012                                 

Definition
replication Factor A 28 kDa subunit
Orthology
K10739  
replication factor A2
Organism
tcr  Trypanosoma cruzi
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:tcr03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tcr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tcr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tcr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 264 aa AA seqDB search
MNLNAYGFSGQTASNAGNGAVGAAAGSNQPQRRMHPIRPVTIKQLLEAQRVGEGVMVVDG
REVTQATVVGRVIGYEDDTTNRVTGALTAKHYGYRITDGTGLVVVRQWMDADHQEEPLPV
QCYVRASGTVKVWQNAPIVTGTVRLVSDCNELNYHYLDVILTHLRLTRGDKHAKEEGAVP
AVSNTASTLGVQNMLPGGGGKVFATDVLLNAIKQNARGDAGLSMDELAAAARQYGFSVND
VRVALRTLAAEGSVYQTHDNRFNI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaaacgcatatggattttccggccagaccgccagtaacgccggtaacggcgcc
gtcggggcggcggccggcagcaatcaaccgcagcgtcgtatgcaccctatccgcccggtg
actataaaacagctgctggaggcgcagcgtgtcggtgagggtgtgatggttgtcgacggc
cgcgaggtcacgcaggcgactgtcgttggtcgtgtgatcggctacgaggacgacacgacc
aaccgagttaccggcgccctcaccgcgaagcactacggttatcgtatcaccgacggcact
ggtcttgttgtggtgcgtcagtggatggacgcggatcatcaggaggagccccttcccgtg
cagtgctacgtgcgggcctctggcaccgtcaaggtgtggcagaacgcccccatcgtgacc
ggcaccgtgcgccttgtctccgattgcaacgaactcaactaccactacctcgatgtcatt
ctcacacacctgcgactgacgaggggcgacaaacacgcgaaggaagaaggcgcggtcccg
gctgttagcaacacggcgagcacgctaggggtacaaaatatgctgccgggtggcgggggc
aaagttttcgcaacggacgtgcttctgaacgcgatcaaacaaaacgcgcggggtgatgcg
gggctctcaatggatgaacttgccgctgcggcacggcagtatgggtttagcgtcaatgat
gtccgtgttgcgttgaggacactggcggcggagggaagcgtgtaccagacgcacgacaac
aggtttaatatttag

DBGET integrated database retrieval system