KEGG   Trypanosoma cruzi: 511003.190Help
Entry
511003.190        CDS       T01012                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tcr  Trypanosoma cruzi
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    511003.190
Enzymes [BR:tcr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     511003.190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 291 aa AA seqDB search
MAPMSKSVVEAKNEDGSSITVHTQGAHLTSWRTREGEEILYTSPNAVYKQGVPIRGGVPI
IFPQFGNRGPLPAHGFARIREWNVKELRSGMASFTLELPSSELRKQGAELRHNNDTSASG
TVSLLYTITFSNEQLKLQMEVTSHDTEADIRFTFAFHTYFAVGDITKTRVDGVNTTSFIN
NLKEQQALQSPEPLWCIREEVDRIYVDQKSAISLLDQARHRTVHVSGENLPDVVLWNPWV
EKTARLKDLPLDGYNKFVCVEHGSIAKEVILPPKGVWKASQCISSRGVSNL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggctccaatgagcaaatcggtcgttgaagcaaaaaacgaggatggctcttccatcact
gtgcatacgcagggcgcccacctaaccagctggcgcacgagggagggcgaggaaattttg
tacacaagtcccaatgctgtctacaagcaaggagtccccattcgaggaggcgttcccatc
atctttccgcagtttggaaatcgtggaccacttcccgcgcacggctttgcgcgtattcgt
gagtggaatgtgaaggaattgcgcagcggaatggcgtccttcacgttggaattaccatcg
agtgagctgcggaagcagggcgcggaattgaggcacaacaacgatacgtcggcctcaggc
accgtttcactgttgtacaccatcaccttcagtaacgagcaacttaagttgcagatggaa
gtcacgagtcacgatacggaggcggatatcagattcacttttgcgtttcacacatatttt
gcggtgggggacattacaaagactcgggtggatggagtaaacacgacttcttttattaac
aacttgaaggaacagcaagcgctgcagtctccagagccgttgtggtgtatcagagaagaa
gtggatcgcatatacgtggatcagaaatctgcgatctcgttgctggaccaggcaaggcat
cggacggtgcacgtatcgggcgagaaccttccagatgttgtgctttggaacccctgggtg
gagaaaaccgcccgattgaaggatcttcctttggacggttacaataagtttgtttgcgtg
gagcacggaagcatcgcaaaagaagtaattctaccgcccaaaggcgtctggaaggcctca
cagtgcatttcttcacgtggcgtctccaatctgtag

DBGET integrated database retrieval system