KEGG   Trypanosoma cruzi: 511019.99Help
Entry
511019.99         CDS       T01012                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tcr  Trypanosoma cruzi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    511019.99
  Metabolism of other amino acids
   00480 Glutathione metabolism
    511019.99
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     511019.99
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 160 aa AA seqDB search
MGSSTVFAYSALMGGKSVALSNYTGRVTVVVNTASLCSFANSSLQQLTHVQETYGPRGFT
ILAFPCAQFANQEPKSNEEIAVWAQTCGLNFPLFDKVKVKGPDAHPLFQMLQASLGPIRW
NYTKFICDREGIPLVKLDSSSFLEELRRSIEQACGPQRGA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcagcacggtgttcgcgtactccgcgctgatgggtggcaaaagcgtggcactc
tccaattacaccgggcgcgtaactgttgtcgtcaacaccgcctccctttgcagttttgcc
aactcgagcctgcagcagttgacacacgtgcaggaaacgtacggaccgcgcggtttcacc
atcctggcttttccctgtgctcagtttgccaaccaggagccgaaaagcaacgaagagatc
gccgtgtgggcgcaaacgtgtggcttgaattttccgctgtttgacaaggtgaaggtgaag
gggccggatgcacacccgttgtttcagatgctgcaggcctcgctcggccctatacgctgg
aattacacgaagtttatatgcgaccgtgaaggcatcccgctggttaaattggactcgtcc
tcctttttggaagagctgcggcgctccatcgagcaggcttgcgggccgcaacggggtgca
tga

DBGET integrated database retrieval system