KEGG   Trypanosoma cruzi: 511047.40Help
Entry
511047.40         CDS       T01012                                 

Definition
NADH-cytochrome B5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tcr  Trypanosoma cruzi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    511047.40
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     511047.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 306 aa AA seqDB search
MLTYVVAAVIIVLTVFLFFKKGVFFSSSMGVALDASKFQNFKLVDKITVSHNSFIFRFAL
HSPTQRLGLPIGQHLHIRCMTTNPDGKPEMVQHAYTPVSSDDDLGHVDFLIKVYFKNVHP
NFPNGGRLSQHLYDLPLGTMVEIRGPVGNFEYLGKGNYTVKDGKGKLKKMHTDAFTMVAG
GTGITPMMQLIRAIMKNKEDRTNIFLVYANQTEDDILLRKELDDCAKDPRMKLWYMLDRE
TSPQWKYGTGYVDEATLRAHVPVLQPRNSDYNRVVALMCGPPPMLQKAVKPNLEKLGYTA
EDMFSF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgtacgtggttgctgcggtcattattgtactcacggtatttctgttctttaag
aagggtgtgtttttctcctcttccatgggagtggccttggatgcgtctaaatttcagaac
tttaagcttgtggataaaattactgtgagtcacaacagttttatctttcgctttgcactc
cactcgcccacacagcgacttggacttcctatcggacaacatcttcacattcgatgcatg
accactaacccagatggaaagccagagatggtgcaacatgcctacactcctgtttcctcc
gatgatgacttgggacatgtggatttcctcattaaagtatacttcaagaacgtgcatccc
aattttcccaacggtggccgtctatcgcagcacctgtacgatcttccactgggcacgatg
gtggaaatacggggtcctgtaggaaactttgagtacctggggaaaggcaattacactgtt
aaggacgggaagggcaaattgaagaagatgcacacggacgccttcacaatggtggcggga
gggacgggtataacaccgatgatgcaactgattcgtgccataatgaaaaataaggaggat
cgcacaaatatttttcttgtctacgcgaatcagaccgaggatgatattctcctgcggaag
gaactggatgactgtgccaaggatccacgcatgaagttgtggtacatgctggaccgcgag
acttctcctcaatggaagtacggcaccggttacgtggatgaggcgacgttgcgggcacat
gttcctgtgctgcagccccggaattccgactacaaccgtgtcgttgcgctgatgtgcggc
ccaccaccgatgctccaaaaagccgtgaagccaaacctggaaaaactcggctacaccgca
gaggacatgttctccttttga

DBGET integrated database retrieval system